| Clone Name | bags7b16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PORB_PSEAE (Q51485) Porin B precursor (Outer membrane protein D1... | 30 | 4.0 | 2 | TIG_PROMM (Q7V991) Trigger factor (TF) | 30 | 6.9 |
|---|
>PORB_PSEAE (Q51485) Porin B precursor (Outer membrane protein D1) (Glucose| porin) Length = 454 Score = 30.4 bits (67), Expect = 4.0 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 421 TALLEPQESTSVDAAAAAFKNVGGGYDDDGSETVKYYDEGKSLSVH-DAEMMMG 579 T LLE ++ A N+ GGYDDD +T +Y D+ +L VH D E ++G Sbjct: 51 TELLEKGYDFKLEYVGEAAANLDGGYDDD--KTGRYTDQ-FALGVHMDLEKILG 101
>TIG_PROMM (Q7V991) Trigger factor (TF)| Length = 479 Score = 29.6 bits (65), Expect = 6.9 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +1 Query: 343 KDGQGTLLMSDHFVFPPSEHENLPIET----ALLEPQESTSVDAAAAAFKNVGGGYDDDG 510 K +G ++ F PS+ + L ++ A L P ES A + G YDDDG Sbjct: 130 KATKGLQAEAEVVTFDPSKVDELIEQSRKQLATLVPVESRPAAIGDIAVVSFSGTYDDDG 189 Query: 511 SETVKYYDEGKSLSVHDAEMMMGDV 585 S + + + D +M+ G V Sbjct: 190 SAIEGGSSDSMDVDLEDGQMIPGFV 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,174,167 Number of Sequences: 219361 Number of extensions: 1309421 Number of successful extensions: 4169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4166 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)