ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags6l18 |
|---|---|
| Clone Library Name | barley_pub |
>YMZ2_YEAST (Q03177) Hypothetical 94.3 kDa Trp-Asp repeats-containing protein| in SNZ1-YPK2 intergenic region Length = 834 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/27 (59%), Positives = 23/27 (85%) Frame = +1 Query: 19 HSKDVLDLCWSKSQYLLXSSMDKTVRL 99 H +DVLD+ WSK+ ++L +SMDKTV+L Sbjct: 277 HVQDVLDINWSKNNFILSASMDKTVKL 303
>YKM1_YEAST (P32330) Hypothetical WD repeat-containing protein YKL121w| Length = 852 Score = 37.4 bits (85), Expect = 0.012 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +1 Query: 10 FAGHSKDVLDLCWSKSQYLLXSSMDKTVRL 99 F H+ D+LD WSK+ +L+ +SMDKT +L Sbjct: 276 FMEHALDILDANWSKNGFLITASMDKTAKL 305
>ELP2_YEAST (P42935) Elongator complex protein 2 (Gamma-toxin target 2)| Length = 788 Score = 35.0 bits (79), Expect = 0.060 Identities = 16/30 (53%), Positives = 23/30 (76%), Gaps = 1/30 (3%) Frame = +1 Query: 13 AGHSKDVLDLCWSKS-QYLLXSSMDKTVRL 99 +G +KDV D+ WS S +YLL +S+D+T RL Sbjct: 382 SGATKDVTDIAWSPSGEYLLATSLDQTTRL 411
>HIRA_DROME (O17468) HIRA protein homolog (dHIRA)| Length = 1047 Score = 32.3 bits (72), Expect = 0.39 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 7 TFAGHSKDVLDLCWSKSQ-YLLXSSMDKTV 93 T GH DVLDL WS + YL S+D TV Sbjct: 124 TLRGHDGDVLDLAWSPNDVYLASCSIDNTV 153
>CAF1B_MOUSE (Q9D0N7) Chromatin assembly factor 1 subunit B (CAF-1 subunit B)| (Chromatin assembly factor I p60 subunit) (CAF-I 60 kDa subunit) (CAF-Ip60) Length = 572 Score = 31.2 bits (69), Expect = 0.86 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSKSQYLLXS-SMDKTV 93 V T GH +DV D+CW+ L+ S S+D TV Sbjct: 122 VKTLRGHLEDVYDICWATDGNLMTSASVDNTV 153
>GBLP_CHICK (P63247) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 317 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 101 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 131
>GBLP_RAT (P63245) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>GBLP_PIG (P63246) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>GBLP_MOUSE (P68040) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (p205) (12-3) Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>GBLP_MACFA (Q4R7Y4) Guanine nucleotide-binding protein beta subunit 2-like 1| Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>GBLP_HUMAN (P63244) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>GBLP_BOVIN (P63243) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 100 FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKL 130
>WDR12_HUMAN (Q9GZL7) WD-repeat protein 12 (YTM1 homolog)| Length = 423 Score = 29.6 bits (65), Expect = 2.5 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSKSQYLLXSSMDKTVRL 99 ++T +GH + V + WS ++ + +S D T+R+ Sbjct: 250 IVTLSGHMEAVSSVLWSDAEEICSASWDHTIRV 282 Score = 28.9 bits (63), Expect = 4.3 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSK----SQYLLXSSMDKTVRL 99 ++T GH+ V D+ W K S LL +SMD+T+ L Sbjct: 133 IMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILL 169
>GBLP_ORENI (O42249) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 101 FVGHTKDVLSVAFSADNRQIVSGSRDKTIKL 131
>GBLP_BRARE (O42248) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 101 FVGHTKDVLSVAFSADNRQIVSGSRDKTIKL 131
>GBLP_TOBAC (P49026) Guanine nucleotide-binding protein beta subunit-like| protein Length = 326 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S DK++RL Sbjct: 102 FVGHTKDVLSVAFSVDNRQIVSASRDKSIRL 132
>GBLP_NICPL (P93340) Guanine nucleotide-binding protein beta subunit-like| protein Length = 326 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S DK++RL Sbjct: 102 FVGHTKDVLSVAFSADNRQIVSASRDKSIRL 132
>GBLP_CHLRE (P25387) Guanine nucleotide-binding protein beta subunit-like| protein Length = 318 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 102 FVGHTKDVLSVAFSVDNRQIVSGSRDKTIKL 132
>CAF1B_HUMAN (Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B)| (Chromatin assembly factor I p60 subunit) (CAF-I 60 kDa subunit) (CAF-Ip60) (M-phase phosphoprotein 7) Length = 559 Score = 29.6 bits (65), Expect = 2.5 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSKSQYLLXS-SMDKT 90 V T GH +DV D+CW+ L+ S S+D T Sbjct: 122 VKTLRGHLEDVYDICWATDGNLMASASVDNT 152
>GBLP_BIOGL (Q93134) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 316 Score = 29.6 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 101 FVGHTKDVLSVAFSADNRQIVSGSRDKTIKL 131
>WDR12_MOUSE (Q9JJA4) WD-repeat protein 12 (YTM1 homolog)| Length = 423 Score = 29.3 bits (64), Expect = 3.3 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSKSQYLLXSSMDKTVRL 99 ++T +GH++ + + WS ++ + +S D T+R+ Sbjct: 250 LVTLSGHTEAISSVLWSDAEEICSASWDHTIRV 282 Score = 29.3 bits (64), Expect = 3.3 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSK----SQYLLXSSMDKTVRL 99 ++T GH+ V D+ W K S LL +SMD+TV L Sbjct: 133 IMTIVGHTDVVKDVAWVKKDSLSCLLLTASMDQTVLL 169
>SPG16_HUMAN (Q8N0X2) Sperm-associated antigen 16 protein (PF20 protein homolog)| Length = 631 Score = 29.3 bits (64), Expect = 3.3 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 1 VITFAGHSKDVLDLCW-SKSQYLLXSSMDKTVRL 99 ++TF GHS+ V W S ++ SS+DKT ++ Sbjct: 429 ILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKI 462
>GBLP_DROME (O18640) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C homolog) Length = 318 Score = 29.3 bits (64), Expect = 3.3 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S DKT++L Sbjct: 102 FEGHTKDVLSVAFSADNRQIVSGSRDKTIKL 132
>AHI1_HUMAN (Q8N157) Jouberin (Abelson helper integration site 1 protein| homolog) (AHI-1) Length = 1196 Score = 29.3 bits (64), Expect = 3.3 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 16 GHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 GH + DL WSK Y+L SS D T R+ Sbjct: 652 GHLNIIYDLSWSKDDHYILTSSSDGTARI 680
>WDR12_RAT (P61480) WD-repeat protein 12| Length = 423 Score = 28.9 bits (63), Expect = 4.3 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSK----SQYLLXSSMDKTVRL 99 ++T GH+ V D+ W K S LL +SMD+T+ L Sbjct: 133 IMTIVGHTDVVKDVAWVKKDSLSCLLLTASMDQTILL 169 Score = 28.5 bits (62), Expect = 5.6 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSKSQYLLXSSMDKTVRL 99 ++T +GH++ + + WS + + +S D TVR+ Sbjct: 250 LVTLSGHTEAISSVLWSDADEVCSASWDHTVRV 282
>GBLP_SOYBN (Q39836) Guanine nucleotide-binding protein beta subunit-like| protein Length = 325 Score = 28.9 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S D+T++L Sbjct: 101 FVGHTKDVLSVAFSIDNRQIVSASRDRTIKL 131
>GBLP_MEDSA (O24076) Guanine nucleotide-binding protein beta subunit-like| protein Length = 325 Score = 28.9 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S D+T++L Sbjct: 101 FVGHTKDVLSVAFSIDNRQIVSASRDRTIKL 131
>GBLP_BRANA (Q39336) Guanine nucleotide-binding protein beta subunit-like| protein Length = 327 Score = 28.9 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S D+T++L Sbjct: 101 FVGHTKDVLSVAFSLDNRQIVSASRDRTIKL 131
>GBLP_ARATH (O24456) Guanine nucleotide-binding protein beta subunit-like| protein (WD-40 repeat auxin-dependent protein ARCA) Length = 327 Score = 28.9 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ +S D+T++L Sbjct: 101 FVGHTKDVLSVAFSLDNRQIVSASRDRTIKL 131
>HIRL_SCHPO (P87314) Histone transcription regulator 1 homolog| Length = 932 Score = 28.5 bits (62), Expect = 5.6 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 16 GHSKDVLDLCWS-KSQYLLXSSMDKTV 93 GH D+ DLCWS SQ ++ +D ++ Sbjct: 132 GHDNDIQDLCWSYDSQLVVSVGLDSSI 158
>GBLP_ORYSA (P49027) Guanine nucleotide-binding protein beta subunit-like| protein (GPB-LR) (RWD) Length = 334 Score = 28.5 bits (62), Expect = 5.6 Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH KDVL + +S ++ ++ +S D+T++L Sbjct: 113 FVGHDKDVLSVAFSVDNRQIVSASRDRTIKL 143
>PWP2_SCHPO (Q9C1X1) Periodic tryptophan protein 2 homolog| Length = 854 Score = 28.1 bits (61), Expect = 7.3 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 1 VITFAGHSKDVLDLCWSK-SQYLLXSSMDKTVR 96 ++TF H+ V LC+SK L SS+D +VR Sbjct: 374 IVTFTQHTSAVSGLCFSKRGNVLFSSSLDGSVR 406
>SEC13_PICPA (P53024) Protein transport protein SEC13| Length = 289 Score = 28.1 bits (61), Expect = 7.3 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +1 Query: 10 FAGHSKDVLDLCWSKSQ----YLLXSSMDKTV 93 F GHS V D+ WS S+ Y+ +S D+TV Sbjct: 192 FQGHSDWVRDVAWSPSRLSKSYIATASQDRTV 223
>TAF5_YEAST (P38129) Transcription initiation factor TFIID subunit 5| (TBP-associated factor 5) (TBP-associated factor 90 kDa) (TAFII-90) Length = 798 Score = 28.1 bits (61), Expect = 7.3 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 7 TFAGHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 T GHS V +S ++YLL S DKTVRL Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRL 551
>AHI1_RAT (Q6DTM3) Jouberin (Abelson helper integration site 1 protein| homolog) (AHI-1) Length = 1047 Score = 28.1 bits (61), Expect = 7.3 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 16 GHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 GH + DL WSK +YL+ SS D T R+ Sbjct: 503 GHLNIIYDLDWSKDDRYLVTSSSDGTARV 531
>AHI1_MOUSE (Q8K3E5) Jouberin (Abelson helper integration site 1 protein)| (AHI-1) Length = 1047 Score = 28.1 bits (61), Expect = 7.3 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 16 GHSKDVLDLCWSK-SQYLLXSSMDKTVRL 99 GH + DL WSK +YL+ SS D T R+ Sbjct: 502 GHLNIIYDLDWSKDDRYLVTSSSDGTARV 530
>GBLP_HYDAT (Q25189) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 27.7 bits (60), Expect = 9.5 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 10 FAGHSKDVLDLCWS-KSQYLLXSSMDKTVRL 99 F GH+KDVL + +S ++ ++ S D T++L Sbjct: 101 FVGHTKDVLSVAFSADNRQIVSGSRDNTIKL 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,381,102 Number of Sequences: 219361 Number of extensions: 87476 Number of successful extensions: 458 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 80,573,946 effective HSP length: 8 effective length of database: 78,819,058 effective search space used: 1891657392 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
