| Clone Name | bags7a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HIS8_WOLSU (Q7M7Y6) Histidinol-phosphate aminotransferase (EC 2.... | 30 | 5.7 | 2 | FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall a... | 29 | 9.8 |
|---|
>HIS8_WOLSU (Q7M7Y6) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 367 Score = 30.0 bits (66), Expect = 5.7 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 346 LWKRKTDCDDVASWVLGRTIELNNLLSLNGNRIQFILGFAEENNVVF 486 L K + D + + W+L R + + NL S N I+ +G + EN+ F Sbjct: 311 LLKNRVDSSEFSQWLLERGLIVRNLKSYGINAIRITIGRSLENDRCF 357
>FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall adhesin FIG2)| Length = 1609 Score = 29.3 bits (64), Expect = 9.8 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = -1 Query: 515 TIKTTPCVHTNTTL-FSSANPSMNWIRFPFRESRLFSSIVLPRTHEATSSQSVFLFHNWK 339 T ++ + ++T+L F+S NPS +W F +S SS + + E + S S ++ Sbjct: 153 TAPSSSSLPSSTSLTFTSVNPSQSWTSFNSEKSSALSSTIDFTSSEISGSTSPKSLESFD 212 Query: 338 L*SFCNSKPRPPPSAR 291 S P PS++ Sbjct: 213 TTGTITSSYSPSPSSK 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,465,838 Number of Sequences: 219361 Number of extensions: 1920966 Number of successful extensions: 4740 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4740 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)