| Clone Name | bags6f20 |
|---|---|
| Clone Library Name | barley_pub |
>UFD1_HUMAN (Q92890) Ubiquitin fusion degradation protein 1 homolog (UB fusion| protein 1) Length = 343 Score = 60.5 bits (145), Expect(2) = 7e-10 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPASSVSVLETDVEVDIEGP 265 AVLE ALRN A L+ DV+ +NY + Y+L+V+E KP +VS++E D+ VD + P Sbjct: 176 AVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAP 230 Score = 21.6 bits (44), Expect(2) = 7e-10 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 9 IQVKYASLPKGTYAKLKPEGVGF 77 +QV+ +L TY+K +P+ F Sbjct: 146 VQVESVNLQVATYSKFQPQSPDF 168
>UFD1_MOUSE (P70362) Ubiquitin fusion degradation protein 1 homolog (UB fusion| protein 1) Length = 307 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 26/55 (47%), Positives = 39/55 (70%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPASSVSVLETDVEVDIEGP 265 AVLE ALRN A ++ DV+ +NY + Y+L+V+E KP +VS++E D+ VD + P Sbjct: 140 AVLENALRNFACMTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAP 194 Score = 21.6 bits (44), Expect(2) = 1e-09 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 9 IQVKYASLPKGTYAKLKPEGVGF 77 +QV+ +L TY+K +P+ F Sbjct: 110 VQVESVNLQVATYSKFQPQSPDF 132
>UFD1_CAEEL (Q19584) Ubiquitin fusion degradation protein 1 homolog (UB fusion| protein 1) Length = 342 Score = 50.8 bits (120), Expect(2) = 3e-09 Identities = 28/75 (37%), Positives = 45/75 (60%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPASSVSVLETDVEVDIEGPDSVFV 280 AVLE LR +A L++ND + +Y + V++LKPA+SV ++E DV +D + P+ +V Sbjct: 144 AVLEVELRKYACLTKNDRIPTSYAGQTLEFLVVDLKPANSVCIIECDVNLDFDPPEG-YV 202 Query: 281 NEENQHVLVPLETGK 325 + Q + P T K Sbjct: 203 EQPRQ--VTPAVTAK 215 Score = 29.3 bits (64), Expect(2) = 3e-09 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 9 IQVKYASLPKGTYAKLKPEGVGF 77 I+++ A+LPK T+AKLKP + F Sbjct: 114 IRIESATLPKATFAKLKPMSLEF 136
>UFD1_DROME (Q9VTF9) Ubiquitin fusion degradation protein 1 homolog (UB fusion| protein 1) Length = 316 Score = 58.5 bits (140), Expect = 9e-09 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPASSVSVLETDVEVDIEGPDSVFV 280 AVLE ALRN A L+ DV+ + Y + Y+L VLE KP ++VS++E D+ V+ E P Sbjct: 137 AVLENALRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKD 196 Query: 281 NEENQ 295 + E Q Sbjct: 197 HSETQ 201
>UFD1_YEAST (P53044) Ubiquitin fusion degradation protein 1 (UB fusion protein| 1) (Polymerase-interacting protein 3) Length = 361 Score = 52.4 bits (124), Expect = 6e-07 Identities = 26/58 (44%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPAS---SVSVLETDVEVDIEGP 265 AVLE LRN +TL+ +DV+ ++Y +K+K+LE+KP S S+ V+ETD+ D P Sbjct: 142 AVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPP 199
>UFD1_SCHPO (O42915) Ubiquitin fusion degradation protein 1 (UB fusion protein| 1) Length = 342 Score = 51.6 bits (122), Expect = 1e-06 Identities = 26/58 (44%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +2 Query: 101 AVLETALRNHATLSENDVVMVNYGQLQYKLKVLELKPASS---VSVLETDVEVDIEGP 265 AVLE ALRN +TL+++D+ + Y Y++KV++++P S VSV+ETD+ VD + P Sbjct: 152 AVLENALRNFSTLTKSDIFEILYNDQVYQIKVIDVQPDDSRHVVSVVETDLVVDFDPP 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,752,113 Number of Sequences: 219361 Number of extensions: 1029865 Number of successful extensions: 2567 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2566 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)