| Clone Name | bags6f16 |
|---|---|
| Clone Library Name | barley_pub |
>GBLP_ORYSA (P49027) Guanine nucleotide-binding protein beta subunit-like| protein (GPB-LR) (RWD) Length = 334 Score = 57.4 bits (137), Expect = 1e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GGYV+AVAVSPDGSLCASGGKDGVTL DL Sbjct: 209 GGYVNAVAVSPDGSLCASGGKDGVTLLWDL 238
>GBLP_BRANA (Q39336) Guanine nucleotide-binding protein beta subunit-like| protein Length = 327 Score = 52.8 bits (125), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYVS VAVSPDGSLCASGGKDGV L DL Sbjct: 195 GYVSTVAVSPDGSLCASGGKDGVVLLWDL 223
>GBLP_ARATH (O24456) Guanine nucleotide-binding protein beta subunit-like| protein (WD-40 repeat auxin-dependent protein ARCA) Length = 327 Score = 52.8 bits (125), Expect = 3e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYVS VAVSPDGSLCASGGKDGV L DL Sbjct: 195 GYVSTVAVSPDGSLCASGGKDGVVLLWDL 223
>GBLP_SOYBN (Q39836) Guanine nucleotide-binding protein beta subunit-like| protein Length = 325 Score = 51.2 bits (121), Expect = 8e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ VAVSPDGSLCASGGKDGV L DL Sbjct: 194 GYVNTVAVSPDGSLCASGGKDGVILLWDL 222
>GBLP_MEDSA (O24076) Guanine nucleotide-binding protein beta subunit-like| protein Length = 325 Score = 51.2 bits (121), Expect = 8e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ VAVSPDGSLCASGGKDGV L DL Sbjct: 194 GYVNTVAVSPDGSLCASGGKDGVILLWDL 222
>GBLP_NEUCR (Q01369) Guanine nucleotide-binding protein beta subunit-like| protein (Cross-pathway control WD-repeat protein cpc-2) Length = 316 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++AV +SPDGSLCASGGKDG T+ DL Sbjct: 193 GYINAVTISPDGSLCASGGKDGTTMLWDL 221
>GBLP_NICPL (P93340) Guanine nucleotide-binding protein beta subunit-like| protein Length = 326 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ AVSPDGSLCASGGKDGV L DL Sbjct: 195 GYVNTTAVSPDGSLCASGGKDGVILLWDL 223
>GBLP_TOBAC (P49026) Guanine nucleotide-binding protein beta subunit-like| protein Length = 326 Score = 48.9 bits (115), Expect = 4e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ AVSPDGSLCASGGKDGV L DL Sbjct: 195 GYVNTPAVSPDGSLCASGGKDGVILLWDL 223
>GBLP_CHLRE (P25387) Guanine nucleotide-binding protein beta subunit-like| protein Length = 318 Score = 48.9 bits (115), Expect = 4e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ V VSPDGSLCASGGKDG+ + DL Sbjct: 195 GYVNTVTVSPDGSLCASGGKDGIAMLWDL 223
>GBLP_SCHPO (Q10281) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C) Length = 314 Score = 48.5 bits (114), Expect = 5e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYVSAV +SPDGSLCASGG+DG + DL Sbjct: 193 GYVSAVTISPDGSLCASGGRDGTLMLWDL 221
>GBLP_LEIMA (Q25306) Guanine nucleotide-binding protein beta subunit-like| protein (Antigen LACK) Length = 312 Score = 47.8 bits (112), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 YVS V VSPDGSLCASGGKDG L DL+ Sbjct: 196 YVSTVTVSPDGSLCASGGKDGAALLWDLS 224
>GBLP_LEIIN (P62884) Guanine nucleotide-binding protein beta subunit-like| protein (Antigen LACK) (LiP36) (p36Li) Length = 312 Score = 47.8 bits (112), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 YVS V VSPDGSLCASGGKDG L DL+ Sbjct: 196 YVSTVTVSPDGSLCASGGKDGAALLWDLS 224
>GBLP_LEICH (P62883) Guanine nucleotide-binding protein beta subunit-like| protein (Antigen LACK) Length = 312 Score = 47.8 bits (112), Expect = 9e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 YVS V VSPDGSLCASGGKDG L DL+ Sbjct: 196 YVSTVTVSPDGSLCASGGKDGAALLWDLS 224
>GBLP_CAEEL (Q21215) Guanine nucleotide-binding protein beta subunit 2-like 1| Length = 324 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ V VSPDGSLCASGGKDG + DL Sbjct: 198 GYVNTVTVSPDGSLCASGGKDGQAMLWDL 226
>GBLP_HYDAT (Q25189) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 47.0 bits (110), Expect = 2e-05 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++AV VSPDGSLCASGGKDG + DL Sbjct: 193 GYLNAVTVSPDGSLCASGGKDGNAMLWDL 221
>GBLP_ORENI (O42249) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 193 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 221
>GBLP_CHICK (P63247) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 317 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 193 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 221
>GBLP_BRARE (O42248) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 317 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 193 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 221
>GBLP_RAT (P63245) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_PIG (P63246) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_MOUSE (P68040) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) (p205) (12-3) Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_MACFA (Q4R7Y4) Guanine nucleotide-binding protein beta subunit 2-like 1| Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_HUMAN (P63244) Guanine nucleotide-binding protein beta subunit 2-like 1| (Guanine nucleotide-binding protein beta subunit-like protein 12.3) (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_BOVIN (P63243) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 316 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLCASGGKDG + DL Sbjct: 192 GYLNTVTVSPDGSLCASGGKDGQAMLWDL 220
>GBLP_BIOGL (Q93134) Guanine nucleotide-binding protein beta subunit 2-like 1| (Receptor of activated protein kinase C) (RACK) Length = 316 Score = 44.7 bits (104), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GYV+ V VSPDGSLCASGGKD + DL Sbjct: 193 GYVNTVTVSPDGSLCASGGKDSQAMLWDL 221
>GBLP_TRYBR (P69104) Guanine nucleotide-binding protein beta subunit-like| protein (Activated protein kinase C receptor homolog) (Track) Length = 318 Score = 42.7 bits (99), Expect = 3e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 YV++V VSPDGSLCAS KDGV DLT Sbjct: 198 YVTSVTVSPDGSLCASSDKDGVARLWDLT 226
>GBLP_TRYBB (P69103) Guanine nucleotide-binding protein beta subunit-like| protein (Activated protein kinase C receptor homolog) Length = 318 Score = 42.7 bits (99), Expect = 3e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 YV++V VSPDGSLCAS KDGV DLT Sbjct: 198 YVTSVTVSPDGSLCASSDKDGVARLWDLT 226
>GBLP_DROME (O18640) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C homolog) Length = 318 Score = 42.7 bits (99), Expect = 3e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDGVTLXGDL 91 GY++ V VSPDGSLC SGGKD L DL Sbjct: 194 GYLNTVTVSPDGSLCTSGGKDSKALLWDL 222
>GBLP_DICDI (P46800) Guanine nucleotide-binding protein beta subunit-like| protein Length = 329 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKD 67 GYV+ V +SPDGSLCASGGKD Sbjct: 199 GYVNTVTISPDGSLCASGGKD 219
>PKWA_THECU (P49695) Probable serine/threonine-protein kinase pkwA (EC| 2.7.11.1) Length = 742 Score = 34.3 bits (77), Expect = 0.10 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDL 91 YV AVA SPDGS+ ASG +DG D+ Sbjct: 587 YVYAVAFSPDGSMVASGSRDGTIRLWDV 614 Score = 31.2 bits (69), Expect = 0.86 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDG 70 YV +A SPDGS+ ASG +DG Sbjct: 545 YVLDIAFSPDGSMVASGSRDG 565 Score = 29.3 bits (64), Expect = 3.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDL 91 +V AVA SPDG+L ASG D D+ Sbjct: 503 WVRAVAFSPDGALLASGSDDATVRLWDV 530 Score = 28.5 bits (62), Expect = 5.6 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKD 67 +V AVA SPDG+L ASG D Sbjct: 670 WVRAVAFSPDGALLASGSDD 689
>HETE1_PODAN (Q00808) Vegetatible incompatibility protein HET-E-1| Length = 1356 Score = 30.8 bits (68), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKDG 70 GG+V +VA SPDG ASG DG Sbjct: 1135 GGWVHSVAFSPDGQRVASGSIDG 1157 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKD 67 GG+V +VA SPDG ASG D Sbjct: 1219 GGWVQSVAFSPDGQRVASGSSD 1240 Score = 30.0 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKD 67 GG+V +VA SPDG ASG D Sbjct: 1177 GGWVQSVAFSPDGQRVASGSSD 1198 Score = 28.1 bits (61), Expect = 7.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKD 67 GG+V +V SPDG ASG D Sbjct: 1051 GGWVQSVVFSPDGQRVASGSDD 1072 Score = 28.1 bits (61), Expect = 7.3 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 2 GGYVSAVAVSPDGSLCASGGKD 67 GG V +VA SPDG ASG D Sbjct: 925 GGRVQSVAFSPDGQRVASGSDD 946
>GBLP_YEAST (P38011) Guanine nucleotide-binding protein beta subunit-like| protein (Receptor of activated protein kinase C 1) (RACK1) (Receptor for activated C kinase) Length = 318 Score = 29.3 bits (64), Expect = 3.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 11 VSAVAVSPDGSLCASGGKDGVTLXGDL 91 ++ + SPDG+L AS GKDG + +L Sbjct: 198 INTLTASPDGTLIASAGKDGEIMLWNL 224
>IF32_YEAST (P40217) Eukaryotic translation initiation factor 3 39 kDa subunit| (eIF3 p39) (Translation initiation factor eIF3, p39 subunit) Length = 347 Score = 28.9 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDG 70 G ++ VA+SP G+ ASGG+DG Sbjct: 294 GPLNTVAISPQGTSYASGGEDG 315
>YY46_ANASP (Q8YRI1) Hypothetical WD-repeat protein alr3466| Length = 1526 Score = 28.5 bits (62), Expect = 5.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 11 VSAVAVSPDGSLCASGGKDGVTLXGDLT 94 V +V SPDG++ ASGG D + D++ Sbjct: 1077 VRSVVFSPDGAMLASGGDDQIVRLWDIS 1104 Score = 27.7 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 8 YVSAVAVSPDGSLCASGGKDGVTLXGDLT 94 +V+AVA SPDG+ ASG D D++ Sbjct: 1160 WVNAVAFSPDGATLASGSGDQTVRLWDIS 1188
>IASPP_HUMAN (Q8WUF5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 828 Score = 28.5 bits (62), Expect = 5.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 87 SPXKVTPSLPPEAQSEP 37 SP ++ P+LPPEAQS P Sbjct: 489 SPTRLQPALPPEAQSVP 505
>IF32_ARATH (Q38884) Eukaryotic translation initiation factor 3 subunit 2| (eIF-3 beta) (eIF3 p36) (eIF3i) (TGF-beta receptor-interacting protein 1) (TRIP-1) Length = 328 Score = 28.1 bits (61), Expect = 7.3 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 5 GYVSAVAVSPDGSLCASGGKDG 70 G ++A+A +PDG +SGG+DG Sbjct: 291 GPINALAFNPDGKSFSSGGEDG 312
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 27.7 bits (60), Expect = 9.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 11 VSAVAVSPDGSLCASGGKDGVTLXGD 88 VSAV+ + DGSL ASG DG+ D Sbjct: 216 VSAVSFNRDGSLIASGSYDGLVRIWD 241
>Y2800_ANASP (Q8YTC2) Hypothetical WD-repeat protein alr2800| Length = 1258 Score = 27.7 bits (60), Expect = 9.5 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 11 VSAVAVSPDGSLCASGGKD 67 VS+VA SPDG + ASG +D Sbjct: 1191 VSSVAFSPDGEVVASGSQD 1209
>TUP1_CANAL (P56093) Transcriptional repressor TUP1| Length = 514 Score = 27.7 bits (60), Expect = 9.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 11 VSAVAVSPDGSLCASGGKDGVTLXGDLT 94 V+ VAVSPDG L A+G D D T Sbjct: 343 VTTVAVSPDGKLIAAGSLDRTVRVWDST 370 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,966,858 Number of Sequences: 219361 Number of extensions: 147170 Number of successful extensions: 986 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 80,573,946 effective HSP length: 7 effective length of database: 79,038,419 effective search space used: 1896922056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)