| Clone Name | bags6e21 |
|---|---|
| Clone Library Name | barley_pub |
>RR3_WHEAT (Q95H49) Chloroplast 30S ribosomal protein S3| Length = 239 Score = 92.0 bits (227), Expect = 3e-19 Identities = 43/55 (78%), Positives = 43/55 (78%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT QKHHSFWFAQPKNYSEGLQEDK D KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQKHHSFWFAQPKNYSEGLQEDKKIRDCIKNYIQKNRKKGS 55
>RR3_SACOF (Q6ENS5) Chloroplast 30S ribosomal protein S3| Length = 224 Score = 88.2 bits (217), Expect = 5e-18 Identities = 41/55 (74%), Positives = 42/55 (76%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFAQPKNYSEGLQEDK + KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGS 55
>RR3_SACHY (Q6L3G0) Chloroplast 30S ribosomal protein S3| Length = 224 Score = 88.2 bits (217), Expect = 5e-18 Identities = 41/55 (74%), Positives = 42/55 (76%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFAQPKNYSEGLQEDK + KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGS 55
>RR3_MAIZE (P06586) Chloroplast 30S ribosomal protein S3| Length = 224 Score = 88.2 bits (217), Expect = 5e-18 Identities = 41/55 (74%), Positives = 42/55 (76%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFAQPKNYSEGLQEDK + KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGS 55
>RR3_ORYSA (P12146) Chloroplast 30S ribosomal protein S3| Length = 239 Score = 88.2 bits (217), Expect = 5e-18 Identities = 41/55 (74%), Positives = 42/55 (76%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFAQPKNYSEGLQEDK + KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGS 55
>RR3_ORYNI (Q6END5) Chloroplast 30S ribosomal protein S3| Length = 239 Score = 88.2 bits (217), Expect = 5e-18 Identities = 41/55 (74%), Positives = 42/55 (76%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFAQPKNYSEGLQEDK + KNY KKGS Sbjct: 1 MGQKINPLGFRLGTTQNHHSFWFAQPKNYSEGLQEDKKIRNCIKNYIQKNRKKGS 55
>RR3_LYCES (Q2MI62) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 80.9 bits (198), Expect = 7e-16 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHHSLWFSQPKNYSEGLQEDKKIRDCIKNY 46
>RR3_PANGI (Q68RW8) Chloroplast 30S ribosomal protein S3| Length = 219 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/55 (69%), Positives = 39/55 (70%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHS WFAQPKNYSEGLQED+ D KNY K S Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFAQPKNYSEGLQEDQKIRDFIKNYVQKNMKISS 55
>RR3_SOLTU (Q2VEE2) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 80.1 bits (196), Expect = 1e-15 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDKKIRDCIKNY 46
>RR3_SOLBU (Q2MIE9) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 80.1 bits (196), Expect = 1e-15 Identities = 36/46 (78%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDKKIRDCIKNY 46
>RR3_GOSHI (Q2L946) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 79.7 bits (195), Expect = 2e-15 Identities = 36/46 (78%), Positives = 36/46 (78%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WFAQPK YSEGLQEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHHSLWFAQPKKYSEGLQEDKKIRDCIKNY 46
>RR3_TOBAC (P06357) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDQKIRDCIKNY 46
>RR3_NICTO (Q33BZ3) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDQKIRDCIKNY 46
>RR3_NICSY (Q3C1L6) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDQKIRDCIKNY 46
>RR3_ATRBE (Q8S8V5) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WF+QPKNYSEGLQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSLWFSQPKNYSEGLQEDQKIRDCIKNY 46
>RR3_ARATH (P56798) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WFAQPK YSEGL+EDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHHSLWFAQPKKYSEGLEEDKKIRDCIKNY 46
>RR3_EPIVI (P30055) Plastid 30S ribosomal protein S3| Length = 220 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHSFWFAQPKNY +G+QED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHHSFWFAQPKNYYKGIQEDQKIRDFIKNY 46
>RR3_NYMAL (Q6EW13) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 78.2 bits (191), Expect = 5e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q H SFWFAQPKNYS+GLQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHRSFWFAQPKNYSKGLQEDEKIRDCIKNY 46
>RR3_LACSA (Q332T8) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 77.8 bits (190), Expect = 6e-15 Identities = 36/55 (65%), Positives = 38/55 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINP+G RLGT Q HHS WFAQPKNYSEGLQEDK +NY K S Sbjct: 1 MGQKINPIGFRLGTTQGHHSLWFAQPKNYSEGLQEDKKIRTYIQNYVQKNMKTSS 55
>RR3_SPIOL (P09595) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 75.5 bits (184), Expect = 3e-14 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 GQKINPLG RLGT Q H+S WF+QPKNY+EGLQED+ D KNY K S Sbjct: 1 GQKINPLGFRLGTTQSHYSLWFSQPKNYAEGLQEDQKIRDCIKNYVQKNTKTSS 54
>RR3_EUCGG (Q49KW0) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q HHS WFAQ KNYS+GLQED+ + KNY Sbjct: 1 MGQKINPLGFRLGTTQGHHSIWFAQAKNYSDGLQEDQKIRNCIKNY 46
>RR3_PHAAO (Q3BAJ8) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 73.2 bits (178), Expect = 2e-13 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q HHSFWFA+PKN+S GLQED+ + K+Y K S Sbjct: 1 MGQKINPLGFRLGTTQSHHSFWFAKPKNFSIGLQEDERIRNCIKDYVKKNKKISS 55
>RR3_SOYBN (Q2PMP7) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/46 (71%), Positives = 34/46 (73%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q H S WFAQP NYSE +QEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSENIQEDKKIRDCIKNY 46
>RR3_CUCSA (Q4VZN0) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 72.0 bits (175), Expect = 3e-13 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLG Q HHS WFA PK YSEGLQED+ D +NY Sbjct: 1 MGQKINPLGFRLGATQGHHSLWFAHPKKYSEGLQEDQKIRDCIQNY 46
>RR3_PHYPA (Q6YXK8) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 71.2 bits (173), Expect = 6e-13 Identities = 32/55 (58%), Positives = 38/55 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLG Q HHS+WFAQPKNYS+ LQED+ + +NY + S Sbjct: 1 MGQKINPLGFRLGVTQNHHSYWFAQPKNYSKLLQEDQKMRNCIENYVYKNIRNSS 55
>RR3_AMBTC (Q70XX2) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 71.2 bits (173), Expect = 6e-13 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q H S WFAQPK+YS LQED+ D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHRSLWFAQPKDYSRNLQEDEKIRDCIKNY 46
>RR3_LOTJA (Q9BBP8) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 70.9 bits (172), Expect = 8e-13 Identities = 34/55 (61%), Positives = 35/55 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLGT Q H S WFAQP NYSE L+EDK D K Y K S Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTNYSENLKEDKKIRDCIKTYIQKTIKISS 55
>RR3_PHAAN (Q8MCA5) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 70.9 bits (172), Expect = 8e-13 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLGT Q H S WFAQP YSE +QEDK D KNY Sbjct: 1 MGQKINPLGFRLGTTQSHDSIWFAQPTKYSENIQEDKKIRDWIKNY 46
>RR3_CALFE (Q7YJU0) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 68.6 bits (166), Expect = 4e-12 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLG Q HHS WFAQPK+Y GLQED+ D K Y Sbjct: 1 MGQKINPLGFRLGENQSHHSLWFAQPKSYCRGLQEDEKIRDCIKIY 46
>RR3_ACOCL (Q3V4Z5) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINPLG RLG Q H S WFAQPK+YS GLQED+ + KNY Sbjct: 1 MGQKINPLGFRLGATQSHLSLWFAQPKSYSMGLQEDEKIRECIKNY 46
>RR3_HUPLU (Q5SD19) Chloroplast 30S ribosomal protein S3| Length = 219 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLG + H+S WFA+P NYSE LQED+ + NY K S Sbjct: 1 MGQKINPLGFRLGITKNHNSHWFAKPNNYSEFLQEDRKVRNCIDNYVHRHVKNSS 55
>RR3_ANTFO (Q85CS9) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 58.5 bits (140), Expect = 4e-09 Identities = 28/55 (50%), Positives = 33/55 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLG Q H S WFA+P NY + L+ED+ + NY K S Sbjct: 1 MGQKINPLGFRLGVTQNHCSHWFAKPNNYYKLLEEDEKMRNCIYNYVRKHIKSSS 55
>RR3_ADICA (Q85FI4) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MG+KI+PLG RLG QKH+S+WFAQ K+Y + L+ED+ + + Y K S Sbjct: 1 MGRKIHPLGFRLGVSQKHYSYWFAQKKDYPKFLEEDRKIRNLVEKYIQKHVKSVS 55
>RR3_PINTH (P41635) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 57.4 bits (137), Expect = 9e-09 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 M QKINPLG RLG Q S WFAQ +NYS+ L+ED+ +NY K S Sbjct: 1 MAQKINPLGFRLGVTQNERSHWFAQQRNYSKDLREDQKIRTCIENYVRTHIKSSS 55
>RR3_PINKO (Q85WZ0) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 M QKINPLG RLG Q S WFAQ +NYS+ L+ED+ +NY K S Sbjct: 1 MAQKINPLGFRLGVTQNDRSHWFAQQRNYSKDLREDQKIRTCIENYVRTHIKSSS 55
>RR3_PICAB (O62951) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 M QKINPLG RLG Q S WFAQ +NYS+ L+ED+ +NY K S Sbjct: 1 MAQKINPLGFRLGVTQNDRSHWFAQQRNYSKDLREDQKIRTCIENYVRTHIKSSS 55
>RR3_ZYGCR (Q32RN6) Chloroplast 30S ribosomal protein S3| Length = 236 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKI+PLG RLG Q HHS WFA NYSE L+ED+ + + Y + S Sbjct: 1 MGQKIHPLGFRLGVTQNHHSTWFAPLNNYSELLKEDERIRNCIQQYVRKYVRSSS 55
>RR3_SPIMX (O98455) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 56.2 bits (134), Expect = 2e-08 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKI+PLG RLG Q+H S WFA+P YS+ L+ED+ + K Y + S Sbjct: 1 MGQKIHPLGFRLGVTQEHLSNWFARPSRYSDLLEEDEKIRNCIKEYVRTHIRNSS 55
>RR3_CYACA (Q9TLT8) Chloroplast 30S ribosomal protein S3| Length = 207 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 MGQKINPL RLG + HHS WFA+P++Y+ LQEDK D Sbjct: 1 MGQKINPLSFRLGINKLHHSSWFARPQSYTAILQEDKKIRD 41
>RR3_MARPO (P06356) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 55.1 bits (131), Expect = 4e-08 Identities = 28/55 (50%), Positives = 32/55 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQKINPLG RLG Q H S+WFA K YS+ +EDK D + Y K S Sbjct: 1 MGQKINPLGFRLGITQNHRSYWFAN-KKYSKVFEEDKKIRDCIELYVQKHIKNSS 54
>RR3_CHAGL (Q8M9V0) Chloroplast 30S ribosomal protein S3| Length = 255 Score = 55.1 bits (131), Expect = 4e-08 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNYXXXXXKKGS 299 MGQK+NPLG RLG Q+HHS+WFA K ++ L+ED+ Y ++ S Sbjct: 1 MGQKVNPLGFRLGVTQEHHSYWFATNKQFAGFLEEDQKIRHYIYQYVQKHIRESS 55
>RS3_SYNP6 (O24695) 30S ribosomal protein S3| Length = 243 Score = 54.3 bits (129), Expect = 7e-08 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 GQKINP+G RLG Q+H S WFA P Y + LQEDK D Sbjct: 1 GQKINPVGFRLGVTQEHRSRWFADPNRYPQLLQEDKKIRD 40
>RR3_CYAPA (P23401) Cyanelle 30S ribosomal protein S3| Length = 219 Score = 53.9 bits (128), Expect = 1e-07 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P+G RLG QKH S WFA PK Y LQED Sbjct: 1 MGQKIHPIGFRLGITQKHRSCWFANPKQYPTLLQED 36
>RR3_STAPU (Q32RV4) Chloroplast 30S ribosomal protein S3| Length = 219 Score = 53.5 bits (127), Expect = 1e-07 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKI+PLG RLG Q H S W QP YSE LQED+ K Y Sbjct: 1 MGQKIHPLGFRLGVTQSHLSNWCVQPSQYSELLQEDEKLRGCIKEY 46
>RR3_PSINU (Q8WHY4) Chloroplast 30S ribosomal protein S3| Length = 220 Score = 53.1 bits (126), Expect = 2e-07 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKN-YSEGLQEDKXXXDXXKNY 272 MGQKI+PLG RLGT Q H S+WFAQ K YS+ ++EDK + + Y Sbjct: 1 MGQKIHPLGFRLGTTQNHCSYWFAQSKKIYSKLVKEDKEIRNCIEKY 47
>RR3_PORPU (P51308) Chloroplast 30S ribosomal protein S3| Length = 230 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+PLG R+G QKH S WFA K+YS LQED Sbjct: 1 MGQKIHPLGFRIGITQKHRSSWFASSKDYSVLLQED 36
>RS3_ANAVT (Q3MFB5) 30S ribosomal protein S3| Length = 260 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P+G RLG Q+H S WFA+P Y E LQED Sbjct: 1 MGQKIHPVGFRLGITQEHQSRWFAEPSRYPELLQED 36
>RS3_ANASP (Q8YPI5) 30S ribosomal protein S3| Length = 260 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P+G RLG Q+H S WFA+P Y E LQED Sbjct: 1 MGQKIHPVGFRLGITQEHQSRWFAEPSRYPELLQED 36
>RR3_OENHO (Q9MTI7) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 50.8 bits (120), Expect = 8e-07 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 M QKINPLG RLGT Q AQPK+YS+GLQED+ D +NY Sbjct: 1 MAQKINPLGFRLGTTQVIIRL-VAQPKDYSDGLQEDQKIRDCIQNY 45
>RS3_PSYAR (Q4FUF0) 30S ribosomal protein S3| Length = 242 Score = 49.3 bits (116), Expect = 2e-06 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG +KH++ W+A PK YSE L D Sbjct: 1 MGQKVHPIGIRLGVVKKHNANWYASPKQYSEYLIND 36
>RS3_SYNY3 (P73314) 30S ribosomal protein S3| Length = 239 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQKI+P+G RLG + H S W+A PK Y E LQED Sbjct: 1 GQKIHPVGFRLGITKDHKSCWYADPKRYPELLQED 35
>RR3_MESVI (Q9MUU2) Chloroplast 30S ribosomal protein S3| Length = 213 Score = 48.5 bits (114), Expect = 4e-06 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+PLG RLG Q+H + WFA+P Y ++ED Sbjct: 1 MGQKIHPLGFRLGVTQEHRAHWFAKPSEYKFLVEED 36
>RR3_NEPOL (Q9TL20) Chloroplast 30S ribosomal protein S3| Length = 221 Score = 47.8 bits (112), Expect = 7e-06 Identities = 22/44 (50%), Positives = 27/44 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MGQKI+PLG RLG Q+H S WFA K Y + E++ D K Sbjct: 1 MGQKIHPLGFRLGITQQHRSTWFAPRKLYVSWIHEERQLRDYLK 44
>RS3_ACIAD (Q6F7R8) 30S ribosomal protein S3| Length = 250 Score = 47.8 bits (112), Expect = 7e-06 Identities = 18/36 (50%), Positives = 28/36 (77%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H++ W+A PK Y+E L +D Sbjct: 1 MGQKVHPIGIRLGVVKRHNANWYANPKQYAEYLLKD 36
>RS3_PROMP (Q7UZV2) 30S ribosomal protein S3| Length = 243 Score = 47.4 bits (111), Expect = 9e-06 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KINP G RLG Q+H S WFA K Y LQED Sbjct: 1 MGNKINPTGFRLGITQEHRSKWFATSKTYPTLLQED 36
>RR3_PSEAK (Q3ZJ85) Chloroplast 30S ribosomal protein S3| Length = 229 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 MGQKI+PLG RLG Q+H S W+A+ +Y + EDK D Sbjct: 1 MGQKIHPLGFRLGITQEHRSKWYAKASDYPRLVLEDKKLRD 41
>RS3_SYNPX (Q7U4J4) 30S ribosomal protein S3| Length = 242 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KINP G RLG Q+H S W+A K+Y LQED Sbjct: 1 MGHKINPTGLRLGITQEHRSRWYASSKSYPALLQED 36
>RS3_SYNEL (P59187) 30S ribosomal protein S3| Length = 238 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P+G RLG Q H S W+A Y E LQED Sbjct: 1 MGQKIHPIGFRLGITQDHRSRWYADSDRYPELLQED 36
>RR3_EUGGR (P19169) Chloroplast 30S ribosomal protein S3| Length = 218 Score = 46.2 bits (108), Expect = 2e-05 Identities = 17/36 (47%), Positives = 27/36 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++PLG RLG + H SFW+ + ++Y+ ++ED Sbjct: 1 MGQKVHPLGFRLGITKSHSSFWYVERRHYASFVKED 36
>RS3_MYCPU (Q98PY8) 30S ribosomal protein S3| Length = 217 Score = 44.7 bits (104), Expect = 6e-05 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MGQK+NP G R G ++H++ W+A+ K++S+ L ED+ Sbjct: 1 MGQKVNPNGFRYGITKQHNAIWYAEKKDFSKFLLEDQ 37
>RK22_WHEAT (Q95H48) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRSFPIKKSMCHITIVLNIV Sbjct: 126 GRSFPIKKSMCHITIVLNIV 145
>RS3_PROM9 (Q318J0) 30S ribosomal protein S3| Length = 243 Score = 44.3 bits (103), Expect = 8e-05 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KI+P G RLG Q+H S WFA K Y LQED Sbjct: 1 MGHKIHPSGLRLGITQEHRSKWFATSKTYPILLQED 36
>RR3_GUITH (O46900) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NPLG RL +H S WFA ++Y + L++D Sbjct: 1 MGQKVNPLGFRLRITSQHRSSWFATKESYPQLLEQD 36
>RS3_TREDE (Q73PM6) 30S ribosomal protein S3| Length = 239 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG + S W+A P+NY++ L ED Sbjct: 1 MGQKVNPTGLRLGINKTWSSRWYAGPRNYADLLLED 36
>RR3_ASTLO (P58133) Plastid 30S ribosomal protein S3| Length = 219 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK NP G R G +KH S W+ + KNYS +++D Sbjct: 1 MGQKTNPNGLRFGKFKKHFSCWYTENKNYSHFVKQD 36
>RS3_PROMT (Q46IR5) 30S ribosomal protein S3| Length = 244 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KI+P G RLG Q+H S W+A K Y LQED Sbjct: 1 MGHKIHPTGIRLGITQEHRSKWYAPSKTYPLLLQED 36
>RR3_ODOSI (P49491) Chloroplast 30S ribosomal protein S3| Length = 214 Score = 43.5 bits (101), Expect = 1e-04 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +PLG RLG Q+H S W+A Y+ L+ED Sbjct: 1 MGQKTHPLGFRLGITQEHRSAWYANFNQYANLLKED 36
>RS3_BLOFL (Q7VQE2) 30S ribosomal protein S3| Length = 235 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + HS W+A KN+S L D Sbjct: 1 MGQKVHPNGMRLGIIKSWHSTWYANNKNFSNNLNND 36
>RS3_PROMA (Q7V9W8) 30S ribosomal protein S3| Length = 243 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KI+P G RLG Q+H S W+A K Y LQED Sbjct: 1 MGHKIHPNGLRLGITQEHRSRWYASSKTYPLLLQED 36
>RS3_MYCMO (Q6KI49) 30S ribosomal protein S3| Length = 225 Score = 43.1 bits (100), Expect = 2e-04 Identities = 16/36 (44%), Positives = 26/36 (72%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G R G +KH++ W+A K++++ L +D Sbjct: 1 MGQKVNPNGFRYGVTKKHNTLWYADKKDFADILLQD 36
>RR3_CYAME (Q85FV7) Chloroplast 30S ribosomal protein S3| Length = 205 Score = 42.7 bits (99), Expect = 2e-04 Identities = 21/46 (45%), Positives = 26/46 (56%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQK +P+G RLG H S WFA YS+ LQED ++Y Sbjct: 1 MGQKTHPVGFRLGITHTHQSHWFAH--QYSKILQEDHAIRQLLRDY 44
>RS3_PROMM (Q7V537) 30S ribosomal protein S3| Length = 242 Score = 42.7 bits (99), Expect = 2e-04 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG KI+P G RLG Q+H S W+A K Y LQED Sbjct: 1 MGHKIHPTGLRLGITQEHRSRWYATSKMYPILLQED 36
>RS3_BDEBA (Q6MJ20) 30S ribosomal protein S3| Length = 221 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED----KXXXDXXKN 269 MGQK+NP+G R+G + S W+A+ + Y E L ED K D KN Sbjct: 1 MGQKVNPIGLRVGVIRTWDSRWYAKGQQYYENLHEDIRLRKFLKDKLKN 49
>RS3_PSEAE (Q9HWE1) 30S ribosomal protein S3| Length = 228 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG ++H S W+A KNY++ L D Sbjct: 1 MGQKVHPNGIRLGIVKEHTSVWYADRKNYADYLFAD 36
>RR3_GRATL (Q6B8V9) Chloroplast 30S ribosomal protein S3| Length = 217 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +PLG R+G + H S WF+ K+Y + QED Sbjct: 1 MGQKTHPLGFRIGITRDHKSSWFSNMKSYPKLAQED 36
>RR3_GRATE (P16631) Chloroplast 30S ribosomal protein S3| Length = 209 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +PLG R+G + H S WF+ K+Y + QED Sbjct: 1 MGQKTHPLGFRIGITRDHKSSWFSNIKSYPKLAQED 36
>RR3_CHLVU (P56365) Chloroplast 30S ribosomal protein S3| Length = 231 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQE 239 MGQK++P+G RLG QKH S+W P+ + +Q+ Sbjct: 1 MGQKVHPIGFRLGITQKHRSYWCTTPQKSALWIQD 35
>RR3_CHLRE (Q08365) Chloroplast 30S ribosomal protein S3 (ORF 712)| Length = 712 Score = 42.0 bits (97), Expect = 4e-04 Identities = 20/38 (52%), Positives = 26/38 (68%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFA--QPKNYSEGLQED 242 MGQK++PLG R+G +KH S WFA Q YS+ + ED Sbjct: 1 MGQKVHPLGFRVGITKKHQSQWFARFQKYAYSQSVFED 38
>RS3_CLOAB (Q97EI4) 30S ribosomal protein S3| Length = 222 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKN 269 MGQK+NP G R+G ++ ++ W+A KN+S L +D KN Sbjct: 1 MGQKVNPHGLRVGVIKEWNAKWYANSKNFSSYLVQDNKIRKFVKN 45
>RS3_BUCAP (Q8K956) 30S ribosomal protein S3| Length = 233 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG +K +S WFA K++++ L D Sbjct: 1 MGQKVHPNGMRLGIIKKWNSVWFANTKDFADHLDSD 36
>RS3_BUCAI (P57585) 30S ribosomal protein S3| Length = 233 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG +K +S WFA K++++ L D Sbjct: 1 MGQKVHPNGMRLGIIKKWNSVWFANTKDFADHLDSD 36
>RS3_GLOVI (Q7NEF8) 30S ribosomal protein S3| Length = 247 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG + H S WFA+ Y L ED Sbjct: 1 MGQKVHPIGLRLGIIRDHRSRWFAKAGEYPALLAED 36
>RR3_CHLEU (P46307) Chloroplast 30S ribosomal protein S3| Length = 800 Score = 41.2 bits (95), Expect = 7e-04 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQ--PKNYSEGLQEDKXXXD 257 MGQK++P G R+G +KH S WFA+ YS+ + ED+ D Sbjct: 1 MGQKVHPSGFRVGITKKHQSQWFARFNKNKYSQTVLEDRMIRD 43
>RS3_BLOPB (Q493K2) 30S ribosomal protein S3| Length = 236 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + HS W+A K++S+ L D Sbjct: 1 MGQKVHPNGVRLGITKTWHSTWYANNKDFSDNLGND 36
>RS3_THICR (Q31IX6) 30S ribosomal protein S3| Length = 228 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG + ++ W+A KNYS+ L D Sbjct: 1 MGQKVHPIGIRLGITKDWNARWYADSKNYSDFLISD 36
>RS3_PSEF5 (Q4K539) 30S ribosomal protein S3| Length = 228 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H S W+A + Y++ L D Sbjct: 1 MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLLAD 36
>RS3_PSEU2 (Q4ZMQ0) 30S ribosomal protein S3| Length = 228 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H S W+A + Y++ L D Sbjct: 1 MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFAD 36
>RS3_PSESM (Q889W5) 30S ribosomal protein S3| Length = 228 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H S W+A + Y++ L D Sbjct: 1 MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFAD 36
>RS3_PSEPF (Q3K5Z4) 30S ribosomal protein S3| Length = 228 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H S W+A + Y++ L D Sbjct: 1 MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFAD 36
>RS3_PSE14 (Q48D42) 30S ribosomal protein S3| Length = 228 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG ++H S W+A + Y++ L D Sbjct: 1 MGQKVHPIGIRLGIVKEHTSVWYADGRTYADYLFAD 36
>RS3_MYCS5 (Q4A5C7) 30S ribosomal protein S3| Length = 226 Score = 40.8 bits (94), Expect = 9e-04 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G R G + H++ WFA Y L ED Sbjct: 1 MGQKVNPNGFRYGVTKAHNTTWFAHKATYGSKLVED 36
>RS3_BACSK (Q5WLQ6) 30S ribosomal protein S3| Length = 220 Score = 40.8 bits (94), Expect = 9e-04 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S W+A K+Y++ L ED Sbjct: 1 MGQKVNPVGLRVGVIRDWDSKWYAGKKDYADLLHED 36
>RS3_RHIME (Q92QG4) 30S ribosomal protein S3| Length = 237 Score = 40.8 bits (94), Expect = 9e-04 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S WFA Y + L ED Sbjct: 1 MGQKINPIGFRLGINRTWDSRWFADNAEYGQLLHED 36
>RS3_MYCH2 (Q601K8) 30S ribosomal protein S3| Length = 227 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G R G + H++ W+A +S L ED Sbjct: 1 MGQKVNPNGFRFGITRNHNAIWYADKNKFSINLLED 36
>RS3_COXBU (O85388) 30S ribosomal protein S3| Length = 227 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S W+A K++++ L ED Sbjct: 1 MGQKVNPVGMRIGITRDWTSNWYADKKDFADRLNED 36
>RS3_BRAJA (Q89J90) 30S ribosomal protein S3| Length = 241 Score = 40.8 bits (94), Expect = 9e-04 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S WFA + Y + L ED Sbjct: 1 MGQKINPIGLRLGINRTWDSRWFAGKQEYGKLLHED 36
>RS3_RHOS4 (Q3J5R6) 30S ribosomal protein S3| Length = 238 Score = 40.8 bits (94), Expect = 9e-04 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQK+NP+G RL + S WFA+ K+Y L ED + +Y Sbjct: 1 MGQKVNPIGMRLQVNRTWDSRWFAESKDYGNLLLEDLKMREFIHDY 46
>RR3_EMIHU (Q4G359) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +P G R+G + H S WFA Y E L+ED Sbjct: 1 MGQKTHPTGFRIGINKSHDSTWFANYGTYGEILKED 36
>RS3_AQUAE (O66437) 30S ribosomal protein S3| Length = 212 Score = 40.0 bits (92), Expect = 0.001 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +P+G RLG ++ S W+A K YS+ L ED Sbjct: 1 MGQKTHPIGFRLGVIKEWPSKWYAPKKEYSKLLHED 36
>RS3_AZOSE (Q5P326) 30S ribosomal protein S3| Length = 278 Score = 40.0 bits (92), Expect = 0.001 Identities = 20/44 (45%), Positives = 24/44 (54%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MGQKI+P G RL + +S WFA +YS L ED D K Sbjct: 1 MGQKIHPTGFRLAVTRDWNSRWFASSGDYSRMLHEDLKVRDFLK 44
>RS3_TREPA (O83225) 30S ribosomal protein S3| Length = 247 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG + S W+A P+ Y+ L ED Sbjct: 1 MGQKVSPIGLRLGINKVWSSRWYAGPREYAALLHED 36
>RS3_COLP3 (Q487Z9) 30S ribosomal protein S3| Length = 231 Score = 40.0 bits (92), Expect = 0.001 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MGQK+NP G RLG + S WFA K+++ L D + K Sbjct: 1 MGQKVNPTGIRLGITKPFASTWFASNKDFASNLDGDHKVREFLK 44
>RK22_ORYSA (P12140) Chloroplast 50S ribosomal protein L22| Length = 149 Score = 40.0 bits (92), Expect = 0.001 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRS PIKK+MCHITIVLNIV Sbjct: 126 GRSSPIKKTMCHITIVLNIV 145
>RK22_ORYNI (Q6END4) Chloroplast 50S ribosomal protein L22| Length = 149 Score = 40.0 bits (92), Expect = 0.001 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRS PIKK+MCHITIVLNIV Sbjct: 126 GRSSPIKKTMCHITIVLNIV 145
>RS3_RHILO (Q98N51) 30S ribosomal protein S3| Length = 241 Score = 40.0 bits (92), Expect = 0.001 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WFA Y + L ED Sbjct: 1 MGQKVNPIGLRLGINRTWDSRWFANTGEYGKLLHED 36
>RS3_PELUB (Q4FLM4) 30S ribosomal protein S3| Length = 226 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S W+A+ K++ L ED Sbjct: 1 MGQKVNPVGFRLGVNRGWDSVWYAKKKDFGNYLIED 36
>RS3_LEPIN (Q9XD30) 30S ribosomal protein S3| Length = 225 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WF+Q +Y + L ED Sbjct: 1 MGQKVNPIGLRIGITRGWDSIWFSQ-SDYKKNLHED 35
>RS3_LEPIC (Q72NG7) 30S ribosomal protein S3| Length = 225 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WF+Q +Y + L ED Sbjct: 1 MGQKVNPIGLRIGITRGWDSIWFSQ-SDYKKNLHED 35
>RS3_PSEPK (Q88QM9) 30S ribosomal protein S3| Length = 228 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG ++H S W+A Y++ L +D Sbjct: 1 MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKD 36
>RS3_CLOTE (Q890P3) 30S ribosomal protein S3| Length = 222 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MGQK++P G R+G + + W+A KN+S+ L ED + K Sbjct: 1 MGQKVHPHGLRVGVIKDWDAKWYADKKNFSDNLVEDNNIRNFVK 44
>RS3_BRUME (Q8YHN4) 30S ribosomal protein S3| Length = 236 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y + L ED Sbjct: 1 MGQKINPIGLRLGVNRTWDSRWYANTGEYGKLLHED 36
>RS3_AGRT5 (Q8UE24) 30S ribosomal protein S3| Length = 243 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y + L ED Sbjct: 1 MGQKINPIGFRLGINRTWDSRWYADTAEYGKLLHED 36
>RS3_DEIRA (Q9RXJ6) 30S ribosomal protein S3| Length = 249 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MG KINP G RLG + +S W+A K Y+ L+ED+ Sbjct: 1 MGNKINPNGFRLGVTKGWNSRWYAGKKQYASLLKEDE 37
>RS3_LACAC (Q5FM84) 30S ribosomal protein S3| Length = 224 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG + S W+A K Y E L+ED Sbjct: 1 MGQKINPNGFRLGVIRDWESKWYAD-KGYKETLKED 35
>RS3_PROAC (Q6A6N2) 30S ribosomal protein S3| Length = 269 Score = 39.3 bits (90), Expect = 0.002 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG H + W+A+ K Y+E + ED Sbjct: 1 MGQKINPHGFRLGVTTDHKTRWYAE-KQYAELVGED 35
>RS3_LEGPL (Q5WZK6) 30S ribosomal protein S3| Length = 218 Score = 39.3 bits (90), Expect = 0.002 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED-KXXXDXXKNYXXXXXKK 293 MGQK+NP+G RLG + +S WFA K Y+E L +D K D K K Sbjct: 1 MGQKVNPIGIRLGIIKDWNSKWFA-GKRYAEFLIQDIKLRSDLKKKLMAAAVSK 53
>RS3_BRUSU (P59180) 30S ribosomal protein S3| Length = 236 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y + L ED Sbjct: 1 MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHED 36
>RS3_BRUAB (Q57CR4) 30S ribosomal protein S3| Length = 236 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y + L ED Sbjct: 1 MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHED 36
>RS3_BRUA2 (Q2YRA1) 30S ribosomal protein S3| Length = 236 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y + L ED Sbjct: 1 MGQKINPIGLRLGINRTWDSRWYANTGEYGKLLHED 36
>RS3_BARQU (Q6FZC8) 30S ribosomal protein S3| Length = 236 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y L ED Sbjct: 1 MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHED 36
>RS3_BARHE (Q6G2X1) 30S ribosomal protein S3| Length = 236 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y L ED Sbjct: 1 MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHED 36
>RS3_LACJO (Q74L83) 30S ribosomal protein S3| Length = 222 Score = 39.3 bits (90), Expect = 0.002 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG + + W+A KNY++ L ED Sbjct: 1 MGQKINPNGFRLGVNRDWEAKWYAD-KNYADTLNED 35
>RS3_CARHZ (Q3A9S2) 30S ribosomal protein S3| Length = 222 Score = 39.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G R+G + + WFA K+Y E L ED Sbjct: 1 MGQKVHPKGLRIGIIKDWDAKWFADKKHYQELLHED 36
>RS3_CAUCR (Q9A8U7) 30S ribosomal protein S3| Length = 250 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WFA Y + L +D Sbjct: 1 MGQKVNPVGLRLGINRTWDSRWFADGNQYGKLLHQD 36
>RS3_THIDA (Q3SLP3) 30S ribosomal protein S3| Length = 234 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MGQKI+P+G RLG + + W+ +N+S+ L ED D K Sbjct: 1 MGQKIHPIGFRLGVQRIWTAKWYGSNRNFSDTLLEDIKVRDYLK 44
>RS3_LEGPH (Q5ZYN7) 30S ribosomal protein S3| Length = 218 Score = 38.9 bits (89), Expect = 0.003 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED-KXXXDXXKNYXXXXXKK 293 MGQK+NP+G RLG + +S WFA K Y+E L +D K D K K Sbjct: 1 MGQKVNPIGIRLGIIKDWNSKWFA-GKRYAEFLIQDIKLRNDLKKKLMAAAVSK 53
>RS3_LEGPA (Q5X853) 30S ribosomal protein S3| Length = 218 Score = 38.9 bits (89), Expect = 0.003 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED-KXXXDXXKNYXXXXXKK 293 MGQK+NP+G RLG + +S WFA K Y+E L +D K D K K Sbjct: 1 MGQKVNPIGIRLGIIKDWNSKWFA-GKRYAEFLIQDIKLRNDLKKKLMAAAVSK 53
>RS3_GEOKA (Q5L417) 30S ribosomal protein S3| Length = 218 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S W+A+ K+Y++ L ED Sbjct: 1 MGQKVNPIGLRIGIIRDWESRWYAE-KDYADLLHED 35
>RS3_BIFLO (P59179) 30S ribosomal protein S3| Length = 267 Score = 38.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEG-----LQEDKXXXDXXKN 269 MGQKINP G RLG + H S WF+ E L++D+ + K+ Sbjct: 1 MGQKINPFGYRLGITENHRSKWFSDSNKAGERYRDFVLEDDQIRKEMSKD 50
>RS3_BACHK (Q6HPQ2) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WFA+ K+Y+ L ED Sbjct: 1 MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHED 35
>RS3_BACHD (Q9Z9K8) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/45 (40%), Positives = 29/45 (64%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKN 269 MGQK+NP+G R+G + S W+A+ K+Y++ L ED + +N Sbjct: 1 MGQKVNPVGLRVGVIRDWESKWYAE-KDYADLLHEDIKIREYIEN 44
>RS3_BACCZ (Q63H84) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WFA+ K+Y+ L ED Sbjct: 1 MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHED 35
>RS3_BACCR (Q81J36) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WFA+ K+Y+ L ED Sbjct: 1 MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHED 35
>RS3_BACC1 (Q73F90) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WFA+ K+Y+ L ED Sbjct: 1 MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHED 35
>RS3_BACAN (Q81VS4) 30S ribosomal protein S3| Length = 219 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S WFA+ K+Y+ L ED Sbjct: 1 MGQKVNPIGLRVGVIRDWESRWFAE-KDYATLLHED 35
>RS3_WIGBR (Q8D206) 30S ribosomal protein S3| Length = 236 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG + S W+A K +S+ L D Sbjct: 1 MGQKVNPNGIRLGIIKSWSSTWYANTKEFSKNLISD 36
>RS3_CORDI (Q6NJC9) 30S ribosomal protein S3| Length = 248 Score = 38.9 bits (89), Expect = 0.003 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RLG S W+A KNY+E L ED Sbjct: 1 MGQKIHPHGLRLGITSDWKSHWYAD-KNYAEYLAED 35
>RS3_SHISS (Q3YWU5) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WFA K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 36
>RS3_SHIDS (Q32B37) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WFA K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 36
>RS3_SHIBS (Q31VW2) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WFA K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 36
>RS3_SALCH (Q57J38) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WFA K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 36
>RS3_CAMJR (Q5HS96) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF N E + ED Sbjct: 1 MGQKVNPIGLRLGINRNWESRWFPTKANLVENIGED 36
>RS3_CAMJE (Q9PLX7) 30S ribosomal protein S3| Length = 233 Score = 38.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF N E + ED Sbjct: 1 MGQKVNPIGLRLGINRNWESRWFPTKANLVENIGED 36
>RS3_CHRVO (Q7NQF8) 30S ribosomal protein S3| Length = 233 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S WFA +N+ E L++D Sbjct: 1 MGQKIHPTGFRLAVNKNWSSKWFASSQNFPEMLKQD 36
>RS3_THEMA (P46772) 30S ribosomal protein S3| Length = 209 Score = 38.5 bits (88), Expect = 0.004 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKN 269 MGQK++P G RLG + WF + KNY E L ED+ KN Sbjct: 1 MGQKVHPRGFRLGLSADWQAKWFNE-KNYKEWLLEDEEIRKIIKN 44
>RS3_METCA (Q605B8) 30S ribosomal protein S3| Length = 223 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG + S WFA K+Y L D Sbjct: 1 MGQKVNPTGIRLGYIKDWSSRWFADSKSYPVFLNND 36
>RS3_NITWN (Q3SSW0) 30S ribosomal protein S3| Length = 231 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G RLG + S W+A Y L ED Sbjct: 1 MGQKINPIGLRLGINRTWDSRWYAGKAEYGRLLHED 36
>RS3_PHYS1 (O66095) 30S ribosomal protein S3| Length = 251 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKNY 272 MGQKINP G RLG + S WF Q K ++ED + N+ Sbjct: 1 MGQKINPNGLRLGIIRTWDSQWFVQDKEIPALIKEDYLIRELINNF 46
>RS3_NITEU (Q820R1) 30S ribosomal protein S3| Length = 215 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RL + S W+ K +S+ L ED Sbjct: 1 MGQKINPTGFRLSVLKNWSSRWYTNTKKFSDFLNED 36
>RS3_RHOPA (Q6N4U0) 30S ribosomal protein S3 (RRP-S3)| Length = 234 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQKINP+G RLG + S WFA Y + L ED Sbjct: 1 GQKINPIGLRLGINRTWDSRWFAGKNEYGKLLHED 35
>RS3_FRATT (Q5NHW2) 30S ribosomal protein S3| Length = 222 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG + S W+A Y+ L ED Sbjct: 1 MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNED 36
>RS3_CLOPE (Q8XHS9) 30S ribosomal protein S3| Length = 222 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MGQK++P G R+G + + W+A KN+++ L ED+ Sbjct: 1 MGQKVHPHGLRVGVIKDWDAKWYADKKNFADNLIEDQ 37
>RS3_DEHSC (Q3ZZL8) 30S ribosomal protein S3| Length = 278 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG+K++P+G RLG + + W A KN++E L ED Sbjct: 1 MGRKVHPIGFRLGIIKDWSAKWHASDKNFAECLTED 36
>RS3_YERPS (Q664S7) 30S ribosomal protein S3| Length = 232 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S W+A K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSD 36
>RS3_YERPE (Q8ZJA6) 30S ribosomal protein S3| Length = 232 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S W+A K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSD 36
>RS3_DESPS (Q6AP65) 30S ribosomal protein S3| Length = 217 Score = 37.7 bits (86), Expect = 0.007 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MGQK+NPLG RL + S W+A K+YS L ED+ Sbjct: 1 MGQKVNPLGIRLNITRTWDSVWYAD-KDYSTFLIEDQ 36
>RS3_LISMO (P66548) 30S ribosomal protein S3| Length = 218 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 MGQK++P+G R+G + S W+A+ K+Y++ L ED D Sbjct: 1 MGQKVHPIGMRIGVIRDWDSKWYAE-KDYADFLHEDLRIRD 40
>RS3_LISMF (Q71WF2) 30S ribosomal protein S3| Length = 218 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 MGQK++P+G R+G + S W+A+ K+Y++ L ED D Sbjct: 1 MGQKVHPIGMRIGVIRDWDSKWYAE-KDYADFLHEDLRIRD 40
>RS3_LISIN (P66549) 30S ribosomal protein S3| Length = 218 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD 257 MGQK++P+G R+G + S W+A+ K+Y++ L ED D Sbjct: 1 MGQKVHPIGMRIGVIRDWDSKWYAE-KDYADFLHEDLRIRD 40
>RS3_BACLD (Q65PA1) 30S ribosomal protein S3| Length = 218 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G R+G + S W+A K+Y++ L ED Sbjct: 1 MGQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHED 35
>RS3_LEIXX (Q6AD01) 30S ribosomal protein S3| Length = 256 Score = 37.7 bits (86), Expect = 0.007 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFA----QPKNYSEGLQED 242 MGQK+NP G RLG H S WF+ + + YS+ L ED Sbjct: 1 MGQKVNPYGFRLGITTDHVSRWFSDSTKKGQRYSDYLAED 40
>RS3_PHOLL (Q7MYF7) 30S ribosomal protein S3| Length = 233 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S W+A K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSD 36
>RS3_ERWCT (Q6CZX6) 30S ribosomal protein S3| Length = 233 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S W+A K +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWYANTKEFADNLDSD 36
>RS3_BURS3 (Q39KG1) 30S ribosomal protein S3| Length = 266 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S W+A N++ LQED Sbjct: 1 MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQED 36
>RS3_BURPS (Q63Q17) 30S ribosomal protein S3| Length = 266 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S W+A N++ LQED Sbjct: 1 MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQED 36
>RS3_BURP1 (Q3JMR9) 30S ribosomal protein S3| Length = 266 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S W+A N++ LQED Sbjct: 1 MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQED 36
>RS3_BURMA (Q62GL1) 30S ribosomal protein S3| Length = 266 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S W+A N++ LQED Sbjct: 1 MGQKIHPTGFRLAVSRNWASRWYANNNNFAAMLQED 36
>RS3_GEOSL (Q748Z4) 30S ribosomal protein S3| Length = 211 Score = 37.7 bits (86), Expect = 0.007 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S W+A+ +YS+ L ED Sbjct: 1 MGQKVNPVGFRLGVIRTWDSRWYAE-ADYSKLLHED 35
>RS3_VIBVY (Q7MPI2) 30S ribosomal protein S3| Length = 233 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA K++++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGD 36
>RS3_VIBVU (Q8DE45) 30S ribosomal protein S3| Length = 233 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA K++++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGD 36
>RS3_VIBCH (Q9KNZ0) 30S ribosomal protein S3| Length = 233 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA K++++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGD 36
>RS3_MANSM (Q65QW1) 30S ribosomal protein S3| Length = 235 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG + S WFA ++++ L D Sbjct: 1 MGQKVNPHGIRLGIVKPWSSTWFANTQDFASNLDGD 36
>RS3_NEIMB (P66551) 30S ribosomal protein S3| Length = 230 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RL + S WFA+ ++S L++D Sbjct: 1 MGQKINPTGFRLAVTKDWASKWFAKSTDFSTVLKQD 36
>RS3_NEIMA (P66550) 30S ribosomal protein S3| Length = 230 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RL + S WFA+ ++S L++D Sbjct: 1 MGQKINPTGFRLAVTKDWASKWFAKSTDFSTVLKQD 36
>RS3_NEIG1 (Q5F5T3) 30S ribosomal protein S3| Length = 230 Score = 37.4 bits (85), Expect = 0.009 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RL + S WFA+ ++S L++D Sbjct: 1 MGQKINPTGFRLAVTKDWASKWFAKSTDFSTVLKQD 36
>RS3_FUSNN (Q8RIG1) 30S ribosomal protein S3| Length = 219 Score = 37.4 bits (85), Expect = 0.009 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXD-XXKNYXXXXXKK 293 MGQK++P G RLG + S W+A K Y + ED + KNY K Sbjct: 1 MGQKVDPRGLRLGITRAWDSNWYADKKEYVKYFHEDVQIKEFIKKNYFHTGISK 54
>RS3_VIBPA (Q87T07) 30S ribosomal protein S3| Length = 232 Score = 37.4 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA K++++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGD 36
>RS3_SALTY (P0A7V6) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_SALTI (P0A7V7) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_SALPA (Q5PIV8) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_ECOLI (P0A7V3) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_ECOL6 (P0A7V4) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_ECO57 (P0A7V5) 30S ribosomal protein S3| Length = 232 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + +S WFA K +++ L D Sbjct: 1 GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSD 35
>RS3_HAEDU (Q7VKD7) 30S ribosomal protein S3| Length = 234 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WFA +++++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNSTWFANTQDFADNLDGD 36
>RS3_SYMTH (Q67JU9) 30S ribosomal protein S3| Length = 267 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G R+G + + W+A +N+S+ L ED Sbjct: 1 MGQKVHPKGLRIGIVKDWDTRWYADKRNFSDLLVED 36
>RS3_HAEI8 (Q4QMB6) 30S ribosomal protein S3| Length = 235 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + S WFA +++++ L+ D Sbjct: 1 MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGD 36
>RS3_GEOMG (Q39Y00) 30S ribosomal protein S3| Length = 211 Score = 37.0 bits (84), Expect = 0.012 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S W+A+ +Y++ L ED Sbjct: 1 MGQKVNPIGFRLGVIRTWDSRWYAE-ADYAKLLHED 35
>RS3_SILPO (Q5LW56) 30S ribosomal protein S3| Length = 235 Score = 36.6 bits (83), Expect = 0.016 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXK 266 MG K+NP+G RL + S W+A K+Y L ED + K Sbjct: 1 MGHKVNPIGMRLQVNRTWDSRWYADTKDYGNLLLEDLAIREFIK 44
>RS3_BUCBP (P59447) 30S ribosomal protein S3| Length = 235 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S WF+ K++++ L D Sbjct: 1 MGQKVHPNGMRLGIIKHWNSVWFSNSKDFAKILDSD 36
>RS3_OCEIH (P59182) 30S ribosomal protein S3| Length = 213 Score = 36.6 bits (83), Expect = 0.016 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDKXXXDXXKN 269 MGQKINP G R+G + S W+A K+Y++ L ED + +N Sbjct: 1 MGQKINPTGLRVGIIKDWESKWYA-GKDYADLLHEDIKIREYLEN 44
>RS3_LACLA (Q9CDW8) 30S ribosomal protein S3| Length = 217 Score = 36.6 bits (83), Expect = 0.016 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K YS+ L ED Sbjct: 1 MGQKVHPIGMRVGVIRDWDAKWYAE-KEYSDYLHED 35
>RS3_MYCPA (Q73SA8) 30S ribosomal protein S3| Length = 280 Score = 36.6 bits (83), Expect = 0.016 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG S W+A K Y++ ++ED Sbjct: 1 MGQKINPYGFRLGITTDWKSRWYAD-KQYADYVKED 35
>RS3_AQUPY (Q9ZI44) 30S ribosomal protein S3| Length = 231 Score = 36.6 bits (83), Expect = 0.016 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK +P+G RLG + S W+ K+Y++ L ED Sbjct: 1 MGQKTHPIGFRLGVIKDWPSKWYPPKKDYAKLLHED 36
>RS3_MYCLE (O32987) 30S ribosomal protein S3| Length = 281 Score = 36.6 bits (83), Expect = 0.016 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG S W+A K Y+E ++ED Sbjct: 1 MGQKINPHGFRLGITTGWKSRWYAD-KQYAEYVKED 35
>RS3_PELCD (Q3A6P1) 30S ribosomal protein S3| Length = 210 Score = 36.2 bits (82), Expect = 0.021 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G RLG + S W+A+ + YS+ L ED Sbjct: 1 MGQKVHPIGFRLGVVKTWSSRWYAEGE-YSQLLHED 35
>RS3_NITOC (Q3J8S0) 30S ribosomal protein S3| Length = 223 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + +S W+A +SE L D Sbjct: 1 MGQKVHPTGIRLGIVKDWNSKWYADSGQFSELLNND 36
>RS3_ENTFA (Q839F8) 30S ribosomal protein S3| Length = 218 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y+E L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYAEFLHED 35
>RS3_PARUW (Q6ME57) 30S ribosomal protein S3| Length = 214 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MGQK+NP+ RL + S WFA K + + L ED+ Sbjct: 1 MGQKVNPISFRLVRTRDWRSKWFANKKEFGDLLVEDQ 37
>RK22_SACOF (Q6ENS4) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRS+ IKK+MC+ITIVLNIV Sbjct: 125 GRSYSIKKTMCNITIVLNIV 144
>RK22_SACHY (Q6L3F9) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRS+ IKK+MC+ITIVLNIV Sbjct: 125 GRSYSIKKTMCNITIVLNIV 144
>RK22_MAIZE (P06589) Chloroplast 50S ribosomal protein L22| Length = 148 Score = 36.2 bits (82), Expect = 0.021 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +1 Query: 1 GRSFPIKKSMCHITIVLNIV 60 GRS+ IKK+MC+ITIVLNIV Sbjct: 125 GRSYSIKKTMCNITIVLNIV 144
>RS3_THIDN (Q30TV8) 30S ribosomal protein S3| Length = 241 Score = 36.2 bits (82), Expect = 0.021 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF K + L ED Sbjct: 1 MGQKVNPIGLRLGINRNWESRWFPNFKTAAAYLGED 36
>RS3_PASMU (Q9CL37) 30S ribosomal protein S3| Length = 235 Score = 36.2 bits (82), Expect = 0.021 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + S WFA +++++ L D Sbjct: 1 MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLDGD 36
>RS3_DEHE1 (Q3Z975) 30S ribosomal protein S3| Length = 278 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MG+K++P+G RLG + + W A K ++E L ED Sbjct: 1 MGRKVHPIGFRLGIIKDWSAKWHASDKGFAECLTED 36
>RS3_RHORT (Q2RQW6) 30S ribosomal protein S3| Length = 223 Score = 35.8 bits (81), Expect = 0.027 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WFA ++Y+ L +D Sbjct: 1 MGQKVNPIGLRLGINRTWDSRWFA-GRDYASLLHQD 35
>RS3_CORJK (Q4JT53) 30S ribosomal protein S3| Length = 247 Score = 35.8 bits (81), Expect = 0.027 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RLG + S W+A K Y++ L ED Sbjct: 1 MGQKIHPHGLRLGITSEWRSRWYAD-KQYADYLAED 35
>RS3_STAS1 (Q49ZG2) 30S ribosomal protein S3| Length = 217 Score = 35.8 bits (81), Expect = 0.027 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGVIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAES (Q8CRG6) 30S ribosomal protein S3| Length = 217 Score = 35.8 bits (81), Expect = 0.027 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGVIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAEQ (Q5HM05) 30S ribosomal protein S3| Length = 217 Score = 35.8 bits (81), Expect = 0.027 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGVIRDWEAKWYAE-KDFASLLHED 35
>RS3_BACSU (P21465) 30S ribosomal protein S3 (BS3) (BS2)| Length = 217 Score = 35.8 bits (81), Expect = 0.027 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK+NP+G R+G + S W+A K+Y++ L ED Sbjct: 1 GQKVNPVGLRIGVIRDWESKWYA-GKDYADFLHED 34
>RS3_BACST (P23309) 30S ribosomal protein S3 (BS2) (BS3/BS4)| Length = 217 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK+NP+G R+G + S W+A+ K+Y++ + ED Sbjct: 1 GQKVNPIGLRIGIIRDWESRWYAE-KDYADLVHED 34
>RS3_SHEON (P59183) 30S ribosomal protein S3| Length = 230 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + S W+A +Y+ L D Sbjct: 1 MGQKVHPNGIRLGITKPWISTWYADKSDYANNLNSD 36
>RS3_NOCFA (Q5Z1V7) 30S ribosomal protein S3| Length = 267 Score = 35.8 bits (81), Expect = 0.027 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP G RLG S W+A K Y++ ++ED Sbjct: 1 MGQKINPHGFRLGITTDWKSRWYAD-KQYADYVKED 35
>RS3_THEFY (Q47LJ9) 30S ribosomal protein S3| Length = 270 Score = 35.8 bits (81), Expect = 0.027 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP G RLG S WFA K Y + ++ED Sbjct: 1 MGQKVNPHGFRLGVTTDFKSRWFAD-KLYKDYVKED 35
>RS3_TROWT (Q83FZ2) 30S ribosomal protein S3| Length = 220 Score = 35.8 bits (81), Expect = 0.027 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQP----KNYSEGLQED 242 MGQKINP G RLG H S W++ + Y++ + ED Sbjct: 1 MGQKINPYGLRLGITTDHVSHWYSDSTRPGQRYADYVSED 40
>RS3_TROW8 (Q83I72) 30S ribosomal protein S3| Length = 220 Score = 35.8 bits (81), Expect = 0.027 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQP----KNYSEGLQED 242 MGQKINP G RLG H S W++ + Y++ + ED Sbjct: 1 MGQKINPYGLRLGITTDHVSHWYSDSTRPGQRYADYVSED 40
>RS3_HELPY (P56010) 30S ribosomal protein S3| Length = 234 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF + + ED Sbjct: 1 MGQKVNPVGLRLGINRNWTSRWFPSARTAPSNIDED 36
>RS3_HELPJ (Q9ZJR9) 30S ribosomal protein S3| Length = 234 Score = 35.8 bits (81), Expect = 0.027 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF + + ED Sbjct: 1 MGQKVNPVGLRLGINRNWTSRWFPSTRTAPSNIDED 36
>RS3_SHIFL (P59184) 30S ribosomal protein S3| Length = 233 Score = 35.4 bits (80), Expect = 0.036 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++ G RLG + +S WFA K +++ L D Sbjct: 1 MGQKVHRNGIRLGIVKPWNSTWFANTKEFADNLDSD 36
>RS3_STAHJ (Q4L8A8) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAW (P66554) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAS (Q6G777) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAR (Q6GEI9) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAN (P66553) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAM (P66552) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAC (Q5HDW4) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_STAAB (Q2YYQ2) 30S ribosomal protein S3| Length = 217 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKINP+G R+G + + W+A+ K+++ L ED Sbjct: 1 MGQKINPIGLRVGIIRDWEAKWYAE-KDFASLLHED 35
>RS3_BORPE (Q7VTC7) 30S ribosomal protein S3| Length = 263 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S WFA K + L ED Sbjct: 1 MGQKIHPTGFRLAVTRNWTSRWFADDKAFGTMLAED 36
>RS3_BORPA (Q7W2F0) 30S ribosomal protein S3| Length = 263 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S WFA K + L ED Sbjct: 1 MGQKIHPTGFRLAVTRNWTSRWFADDKAFGTMLAED 36
>RS3_BORBR (Q7WRB9) 30S ribosomal protein S3| Length = 263 Score = 35.4 bits (80), Expect = 0.036 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S WFA K + L ED Sbjct: 1 MGQKIHPTGFRLAVTRNWTSRWFADDKAFGTMLAED 36
>RS3_RHOBA (Q7UN14) 30S ribosomal protein S3| Length = 236 Score = 35.4 bits (80), Expect = 0.036 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQEDK 245 MGQK+NP+ R G + S W+A +++++ L ED+ Sbjct: 1 MGQKVNPIAFRTGVTRGWGSRWYASKQDFADLLVEDR 37
>RS3_HELHP (Q7VGD8) 30S ribosomal protein S3| Length = 236 Score = 35.4 bits (80), Expect = 0.036 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK+NP+G RLG + S WF+ + + ED Sbjct: 1 MGQKVNPIGLRLGINRNWSSRWFSVSQTTPSNILED 36
>RS3_VIBF1 (Q5E8A9) 30S ribosomal protein S3| Length = 232 Score = 35.4 bits (80), Expect = 0.036 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA + +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNATWFASSQEFADNLDGD 36
>RS3_DECAR (Q47J97) 30S ribosomal protein S3| Length = 261 Score = 35.4 bits (80), Expect = 0.036 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQKI+P G RL + S W+A K++ L ED Sbjct: 1 MGQKIHPTGFRLAVTKNWSSRWYANSKDFPGMLNED 36
>RS3_PHOPR (Q6LVB0) 30S ribosomal protein S3| Length = 229 Score = 35.4 bits (80), Expect = 0.036 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ WFA + +++ L D Sbjct: 1 MGQKVHPNGIRLGIVKPWNTTWFANSQEFADNLDGD 36
>RS3_IDILO (Q5QXY3) 30S ribosomal protein S3| Length = 226 Score = 35.0 bits (79), Expect = 0.047 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P G RLG + ++ W+A +++ L D Sbjct: 1 MGQKVHPNGIRLGISRPWNATWYANTNEFADNLHSD 36
>RS3_HAEIN (P44372) 30S ribosomal protein S3| Length = 234 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + S WFA +++++ L+ D Sbjct: 1 GQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGD 35
>RS3_ACTAC (P55827) 30S ribosomal protein S3| Length = 234 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +3 Query: 138 GQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 GQK++P G RLG + S WFA +++++ L+ D Sbjct: 1 GQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGD 35
>RS3_STRT2 (Q5M2B9) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGLRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRT1 (Q5LXR7) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGLRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRR6 (P0A4C4) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRPN (P0A4C3) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRPM (Q48VU3) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRP8 (P66557) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRP6 (Q5XEC9) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRP3 (P66556) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRP1 (P66555) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRMU (P59186) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRA5 (P66559) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35
>RS3_STRA3 (P66558) 30S ribosomal protein S3| Length = 217 Score = 35.0 bits (79), Expect = 0.047 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +3 Query: 135 MGQKINPLGXRLGTXQKHHSFWFAQPKNYSEGLQED 242 MGQK++P+G R+G + + W+A+ K Y++ L ED Sbjct: 1 MGQKVHPIGMRVGIIRDWDAKWYAE-KEYADYLHED 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,311,299 Number of Sequences: 219361 Number of extensions: 424872 Number of successful extensions: 1134 Number of sequences better than 10.0: 346 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1132 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)