| Clone Name | bags6d24 |
|---|---|
| Clone Library Name | barley_pub |
>YLHA_CAEEL (P34365) Hypothetical protein C48B4.11| Length = 307 Score = 33.1 bits (74), Expect = 0.68 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 140 WIFTEFFFAAILRLQLCETKFRTFLYFMFTSNMYCYKI 253 +IF FF A++ L +C+++F L+F + S YC I Sbjct: 40 FIFLAFFEFAVVALYVCKSRFLQVLHFQYQSVAYCVPI 77
>D106A_PANTR (Q5IAB3) Beta-defensin 106A precursor (Defensin, beta 106A)| (Defensin, beta 106) (Beta-defensin 6) (DEFB-6) (BD-6) (cBD-6) Length = 65 Score = 31.2 bits (69), Expect = 2.6 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 285 SYFLLWLMLFMVSPFPSYIDNKSCSKLVLYCKNLCMKSSQL 407 ++ L+ +LF ++P + ++ C+KL CKN C K+ +L Sbjct: 3 TFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEEL 43
>D106A_HUMAN (Q8N104) Beta-defensin 106A precursor (Beta-defensin 6) (DEFB-6)| (BD-6) Length = 65 Score = 31.2 bits (69), Expect = 2.6 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 285 SYFLLWLMLFMVSPFPSYIDNKSCSKLVLYCKNLCMKSSQL 407 ++ L+ +LF ++P + ++ C+KL CKN C K+ +L Sbjct: 3 TFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEEL 43
>TRMB_CHLMU (Q9PL91) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 224 Score = 30.4 bits (67), Expect = 4.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 184 LKPQDCSKKEFSEDPCPPFESMIHFLSQPFPFYK 83 +KPQD F ED CP E+ + ++ +P Y+ Sbjct: 1 MKPQDLKLPYFWEDRCPKIENHVFYVPSYYPKYE 34
>YAP3_YEAST (P38749) AP-1-like transcription factor YAP3| Length = 330 Score = 30.0 bits (66), Expect = 5.7 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 7 LPAGSKAVKRKANFEESKKFKERLQAYKKEMAEKENES 120 +P SKA K+ N K F+ER +A KE+ +K ES Sbjct: 142 VPDDSKAKKKAQNRAAQKAFRERKEARMKELQDKLLES 179
>RAD50_SULAC (O33600) DNA double-strand break repair rad50 ATPase| Length = 886 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 28 VKRKANFEESKKFKERLQAYKKEMAEKENE 117 +KRK EE +K E ++ KKE+ EKE + Sbjct: 325 LKRKKELEEKEKQYEEIEKRKKELEEKEKQ 354 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,185,213 Number of Sequences: 219361 Number of extensions: 1536651 Number of successful extensions: 3773 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3772 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)