| Clone Name | bags6d18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DHX9_CAEEL (Q22307) Probable ATP-dependent RNA helicase A (EC 3.... | 30 | 2.0 | 2 | OCTN3_MOUSE (Q9WTN6) Organic cation/carnitine transporter 3 (Sol... | 28 | 4.5 | 3 | ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein ... | 28 | 5.9 | 4 | Y2118_AQUAE (O67882) Hypothetical protein aq_2118 | 28 | 7.7 |
|---|
>DHX9_CAEEL (Q22307) Probable ATP-dependent RNA helicase A (EC 3.6.1.-) (Nuclear| DNA helicase II) (NDH II) Length = 1301 Score = 29.6 bits (65), Expect = 2.0 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 77 PSGTELLTDTAKLYKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYA 220 P LLTD A + K N E DWGP S F Q PP A Sbjct: 1165 PIKDSLLTDNALIQKGPAPNRLEYADWGP---SNNNSSFQNQDFPPAA 1209
>OCTN3_MOUSE (Q9WTN6) Organic cation/carnitine transporter 3 (Solute carrier| family 22 member 21) (Solute carrier family 22 member 9) Length = 564 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 17 YTSNTTRAGISRADQYYAXYPSGTELLTDTAKLYKAALGNC 139 +T T G+ Y A + GTE+L+ + ++ A LG C Sbjct: 196 FTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVC 236
>ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 956 Score = 28.1 bits (61), Expect = 5.9 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -1 Query: 213 GGLPCRSKCFAMMENSIGPQSSISKQLPNAAL*SFAVSVSNSVPE 79 G LP S C M + P SSIS L N AL + A S S+P+ Sbjct: 49 GALPTCSACHKMAPRTETPVSSISNSLEN-ALHTSAHSTEESLPK 92
>Y2118_AQUAE (O67882) Hypothetical protein aq_2118| Length = 173 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +2 Query: 62 YYAXYPSGTELLTDTAKLYKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPY 217 Y YPSG+ + KL K A ++DD+ + KH + +G PP+ Sbjct: 112 YEFPYPSGSIDFYEEEKLVKLA-----KLDDFKVFALDSLGKHENYEGLPPF 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,380,236 Number of Sequences: 219361 Number of extensions: 630412 Number of successful extensions: 1438 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1438 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)