ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags6c12 |
|---|---|
| Clone Library Name | barley_pub |
>GTR1_MOUSE (P17809) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) (GT1) Length = 492 Score = 31.6 bits (70), Expect = 1.9 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL RL W+ +LS++ + A + G Sbjct: 336 LHLIGLAGMAGCAVLMTIALALLERLPWMSYLSIVAIFGFVAFFEVG 382
>GTR1_BOVIN (P27674) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) Length = 492 Score = 31.6 bits (70), Expect = 1.9 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL RL W+ +LS++ + A + G Sbjct: 336 LHLIGLAGMAGCAVLMTIALALLERLPWMSYLSIVAIFGFVAFFEVG 382
>DPOL_THEFM (P74918) DNA polymerase (EC 2.7.7.7) (Pol Tfu) [Contains:| Endonuclease PI-TfuI (EC 3.1.-.-) (Tfu pol-1 intein); Endonuclease PI-TfuII (EC 3.1.-.-) (Tfu pol-2 intein)] Length = 1523 Score = 30.4 bits (67), Expect = 4.3 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -3 Query: 491 KPDDDLYRIYNFRSSMY--ISEPHETVNFGNASKLFARKPLRPKL 363 K D +YR++ F +S Y ++E H + + N SK+ KPL+ +L Sbjct: 966 KTDKRIYRVW-FTNSWYLDVTEDHSLIGYLNTSKVKPGKPLKERL 1009
>GTR1_HUMAN (P11166) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) (HepG2 glucose transporter) Length = 492 Score = 30.4 bits (67), Expect = 4.3 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL +L W+ +LS++ + A + G Sbjct: 336 LHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVG 382
>S12A3_PSEAM (P55019) Solute carrier family 12 member 3 (Thiazide-sensitive| sodium-chloride cotransporter) (Na-Cl symporter) Length = 1023 Score = 30.4 bits (67), Expect = 4.3 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 3/117 (2%) Frame = -1 Query: 583 TK*VYATKMGH*LNIYTTSFSKPKVMVLEARNQTMIFTGSITSDLRCTFLSLMK-Q*TSE 407 TK + GH + + S+ V L R + G + +DLR L++ Sbjct: 665 TKRLSLMMCGHVVTAGPSPVSERHVTWLNQRKVRSFYRGVVAADLRSGVNMLLQGAGLGR 724 Query: 406 MHPSCLL-GSR*DLNCQFHSKAWSQMPQALAHRWIQALAH-LDLHYQYCPSLISEGL 242 + P+ LL G + D C PQA AH +I L DLHY C + EGL Sbjct: 725 IKPNVLLMGFKKDWGCD--------SPQA-AHHYIGILHDAFDLHYGVCVLRVKEGL 772
>DPOL_THEG8 (Q9HH84) DNA polymerase (EC 2.7.7.7) [Contains: Endonuclease| PI-TspGE8I (EC 3.1.-.-) (Tsp-GE8 pol-1 intein); Endonuclease PI-TspGE8II (EC 3.1.-.-) (Tsp-GE8 pol-2 intein)] Length = 1699 Score = 30.4 bits (67), Expect = 4.3 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = -3 Query: 491 KPDDDLYRIYNFRSSMY--ISEPHETVNFGNASKLFARKPLRPKL 363 K + +YR++ F +S Y ++E H + + N SK+ + KPL+ +L Sbjct: 1141 KTNKKIYRVW-FTNSWYLDVTEDHSLIGYLNTSKVKSEKPLKERL 1184
>GTR1_RAT (P11167) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) Length = 492 Score = 30.0 bits (66), Expect = 5.7 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL +L W+ +LS++ + A + G Sbjct: 336 LHLIGLAGMAGCAVLMTIALALLEQLPWMSYLSIVAIFGFVAFFEVG 382
>BBR1_SCHCO (P78741) Pheromone B beta 1 receptor| Length = 541 Score = 30.0 bits (66), Expect = 5.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 380 PLRPKLSVPLKSLESNAPSSGSPVDSGIGTSGFALSVLPK 261 P K + PL SL+ +A + + S + TSG+ + +LP+ Sbjct: 382 PPPQKYTSPLDSLDYSADADRISISSSVDTSGYTIEILPE 421
>GTR1_PIG (P20303) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) (Fragment) Length = 451 Score = 30.0 bits (66), Expect = 5.7 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL +L W+ +LS++ + A + G Sbjct: 295 LHLIGLAGMAGCAVLMTIALALLEQLPWMSYLSIVAIFGFVAFFEVG 341
>GTR1_SHEEP (P79365) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1, erythrocyte/brain) (Fragment) Length = 390 Score = 30.0 bits (66), Expect = 5.7 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL +L W+ +LS++ + A + G Sbjct: 234 LHLIGLAGMAGCAVLMTIALALLEQLPWMSYLSIVAIFGFVAFFEVG 280
>GTR1_CHICK (P46896) Solute carrier family 2, facilitated glucose transporter| member 1 (Glucose transporter type 1) (GT1) Length = 490 Score = 29.3 bits (64), Expect = 9.7 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = +2 Query: 92 MHFPGIKLQLGCSLQLMATVVLLPRLSWVQFLSLIQMATSDALLKAG 232 +H G+ GC++ + + LL ++ W+ +LS++ + A + G Sbjct: 335 LHLIGLAGMAGCAILMTIALTLLDQMPWMSYLSIVAIFGFVAFFEIG 381 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,110,547 Number of Sequences: 219361 Number of extensions: 1767703 Number of successful extensions: 4332 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4332 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
