| Clone Name | bags6c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRIM7_HUMAN (Q9C029) Tripartite motif protein 7 (Glycogenin-inte... | 32 | 0.72 | 2 | RL103_ORYSA (Q40649) 60S ribosomal protein L10-3 (QM/R22) | 30 | 2.7 | 3 | VE2_HPV49 (P36795) Regulatory protein E2 | 30 | 4.7 | 4 | RIF1_HUMAN (Q5UIP0) Telomere-associated protein RIF1 (Rap1-inter... | 29 | 7.9 | 5 | VE2_HPV05 (P06921) Regulatory protein E2 | 29 | 7.9 |
|---|
>TRIM7_HUMAN (Q9C029) Tripartite motif protein 7 (Glycogenin-interacting| protein) (RING finger protein 90) Length = 511 Score = 32.3 bits (72), Expect = 0.72 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +2 Query: 80 DQKIQASQDMMA*KQNVCNGGHEHFKIFNQQEKM*LREILSKFHAGHDQIGATVQQLRA 256 D+ +Q +++++ + V E ++F EK +E+L + A +++GA Q LRA Sbjct: 167 DEAVQEAKELLESRLRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRA 225
>RL103_ORYSA (Q40649) 60S ribosomal protein L10-3 (QM/R22)| Length = 219 Score = 30.4 bits (67), Expect = 2.7 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = +1 Query: 10 MGSRDSTRQYKQ*THREHLQRSY--GSKDTSIARYD-GMKAKCVQRRSRALQNIQPAREN 180 MG R + R Y+Q ++ + + Y G D I YD GMK K V S + + +EN Sbjct: 1 MGRRPA-RCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFSHCVHLVSWEKEN 59 Query: 181 VTTR--DSKQVSCRTRSNRSYG 240 VT+ ++ +++C +S G Sbjct: 60 VTSEALEAARIACNKYMTKSAG 81
>VE2_HPV49 (P36795) Regulatory protein E2| Length = 488 Score = 29.6 bits (65), Expect = 4.7 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = +1 Query: 76 YGSKDTSIARYDGMKAKCVQRRSRALQNIQPARENVTTRDSKQVSCRTRSNR-------S 234 YG KD+S + + +RRSR+ + RE T+R K R+RS S Sbjct: 261 YGRKDSSPTAASNSRKEVSRRRSRSRTRTR-RREASTSRSQKASRSRSRSRSTSRGSRGS 319 Query: 235 YGSTTTSK 258 GS TTS+ Sbjct: 320 GGSVTTSR 327
>RIF1_HUMAN (Q5UIP0) Telomere-associated protein RIF1 (Rap1-interacting factor 1| homolog) Length = 2472 Score = 28.9 bits (63), Expect = 7.9 Identities = 24/98 (24%), Positives = 44/98 (44%) Frame = +2 Query: 53 IENISNGATDQKIQASQDMMA*KQNVCNGGHEHFKIFNQQEKM*LREILSKFHAGHDQIG 232 IEN + +++ K + S+ + K N +E I +Q+EK+ +E + + HD Sbjct: 1549 IENSESDSSEAKEEGSRKKRSGKWK--NKSNESVDIQDQEEKVVKQECIKAENQSHDYKA 1606 Query: 233 ATVQQLRAKQEIFTICQKQPHGSLYASQLRLHNSDKLK 346 + + + K IC+KQ + Q SD L+ Sbjct: 1607 TSEEDVSIKS---PICEKQDESNTVICQDSTVTSDLLQ 1641
>VE2_HPV05 (P06921) Regulatory protein E2| Length = 514 Score = 28.9 bits (63), Expect = 7.9 Identities = 27/83 (32%), Positives = 42/83 (50%) Frame = +1 Query: 40 KQ*THREHLQRSYGSKDTSIARYDGMKAKCVQRRSRALQNIQPARENVTTRDSKQVSCRT 219 KQ E R YG + +S +R +++ QRRSR+ +R +R SK + T Sbjct: 238 KQPQQTETRGRRYGRRPSSKSR----RSQTQQRRSRSRHR---SRSRSRSR-SKSQTHTT 289 Query: 220 RSNRSYGSTTTSKTRNLHNLSKT 288 RS ST+ +KTR L + S++ Sbjct: 290 RSTTRSRSTSLTKTRALTSRSRS 312 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,215,286 Number of Sequences: 219361 Number of extensions: 988994 Number of successful extensions: 2518 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2516 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)