| Clone Name | bags5m13 |
|---|---|
| Clone Library Name | barley_pub |
>HXD3A_BRARE (O42370) Homeobox protein Hox-D3a (Hox-D3) (Fragment)| Length = 167 Score = 30.4 bits (67), Expect = 2.4 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 Query: 237 WFKNMGSRFPSHQLSSGLYVSGRPEQPKEKAPTFGSNVMPYTG 365 WF+N ++ Q S G+ S P P GSN + Y+G Sbjct: 20 WFQNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGSNHIGYSG 62
>ATCU_RHILV (Q9X5V3) Copper-transporting P-type ATPase (EC 3.6.3.4)| Length = 841 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -2 Query: 382 DFLVSPPVYGITLDPKVGAFSLGCSGR 302 D +V P+ G+T+DP+ G SLG GR Sbjct: 31 DAIVRDPICGMTVDPQAGKPSLGHGGR 57
>ZBTB9_HUMAN (Q96C00) Zinc finger and BTB domain-containing protein 9| Length = 473 Score = 30.0 bits (66), Expect = 3.2 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 9/68 (13%) Frame = +3 Query: 291 YVSGRPEQPKEKAPTFGSNVMP---------YTGGDTKKSGELGKMFELHAERSRKSGPL 443 Y+ P +PKE+ GS P ++GGDT+ +GELG F L + SG Sbjct: 284 YIKQEPFEPKEEIS--GSGTQPGGAKEETKVFSGGDTEGNGELG--FLLPSGPGPTSG-- 337 Query: 444 GNAPSRNP 467 G PS P Sbjct: 338 GGGPSWKP 345
>EPL1_KLULA (Q6CIN8) Enhancer of polycomb-like protein 1| Length = 806 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 270 HQLSSGLYVSGRPEQPKEKAPTFGSN 347 H+ SGLY + +PK+K P GSN Sbjct: 422 HKEDSGLYADEKGSEPKKKGPKTGSN 447
>TRIO_HUMAN (O75962) Triple functional domain protein (PTPRF-interacting protein)| Length = 3038 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 14 SPICSISSLPPHSVGAAAQPKP 79 SP S++SL PH +GA + P P Sbjct: 1686 SPPASVASLQPHMIGAQSSPGP 1707
>GAG_HV1RH (P05890) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 500 Score = 28.5 bits (62), Expect = 9.2 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +3 Query: 249 MGSRFPSHQLSSGLYVSGRPE--QPKEKAPTFGSNVMPYTGGDTKKSGELGKMFELHAER 422 +G +PSH+ G ++ RPE P E++ FG P ++K ++ K EL+ Sbjct: 435 LGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTP-----SQKQEKIDK--ELYPLA 487 Query: 423 SRKSGPLGNAPS 458 S KS GN PS Sbjct: 488 SLKS-LFGNDPS 498 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,768,143 Number of Sequences: 219361 Number of extensions: 1362227 Number of successful extensions: 3983 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3973 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)