| Clone Name | bags5k08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RUVX_STRAW (Q827S3) Putative Holliday junction resolvase (EC 3.1... | 31 | 3.7 | 2 | NFCP_CONPS (Q95W11) GFP-like non-fluorescent chromoprotein (cpCP) | 31 | 3.7 | 3 | YQU3_CAEEL (Q09550) Hypothetical protein F26C11.3 precursor | 30 | 4.8 | 4 | NFCP_CONGI (Q95W86) GFP-like non-fluorescent chromoprotein (cgCP) | 30 | 6.3 |
|---|
>RUVX_STRAW (Q827S3) Putative Holliday junction resolvase (EC 3.1.-.-)| Length = 156 Score = 30.8 bits (68), Expect = 3.7 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 468 TVPAFARPPAHRAINMLIDTADNMKLVLGYPRLL 367 TVP P AHR + L++ + +++VLG PR L Sbjct: 35 TVPGRDVPAAHRRLKQLVEEYEPIEVVLGLPRSL 68
>NFCP_CONPS (Q95W11) GFP-like non-fluorescent chromoprotein (cpCP)| Length = 227 Score = 30.8 bits (68), Expect = 3.7 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 11/56 (19%) Frame = +1 Query: 388 YKLHVICGVNEHVDGPVRRGPGKGWYRCSHI-----------NFLATHSAGTPPML 522 YK+ V+ G N DGPV + GW C+ I N +A +G PP++ Sbjct: 117 YKVKVL-GTNFPADGPVMKNISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLI 171
>YQU3_CAEEL (Q09550) Hypothetical protein F26C11.3 precursor| Length = 1317 Score = 30.4 bits (67), Expect = 4.8 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 443 GGLAKAGTVAPTSTSLLPILRVHLQCSSLLNVPTMAPRCACAVL 574 G LA T TST +PI+R+ + +VPT C VL Sbjct: 79 GVLAFKTTTIETSTKFIPIVRIDSTTAETTSVPTTTTSIQCGVL 122
>NFCP_CONGI (Q95W86) GFP-like non-fluorescent chromoprotein (cgCP)| Length = 227 Score = 30.0 bits (66), Expect = 6.3 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 11/56 (19%) Frame = +1 Query: 388 YKLHVICGVNEHVDGPVRRGPGKGWYRCSHI-----------NFLATHSAGTPPML 522 YK+ V+ G N DGPV + GW C+ I N +A +G PP++ Sbjct: 117 YKVKVL-GTNFPADGPVMKKISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLI 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,297,910 Number of Sequences: 219361 Number of extensions: 2180120 Number of successful extensions: 6146 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6128 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)