| Clone Name | bags5h03 |
|---|---|
| Clone Library Name | barley_pub |
>ZN161_HUMAN (Q14119) Zinc finger protein 161 (Putative transcription factor| DB1) Length = 516 Score = 32.3 bits (72), Expect = 0.98 Identities = 28/78 (35%), Positives = 35/78 (44%) Frame = -2 Query: 248 TLPCPFSTVPSVFSFTICSSLITRS*ILFACGCEWSSAVNR*TLPLCST*LHPGSFLSPR 69 TL PFS SV S T+ + + + + SSAVN T P+ HP + SP Sbjct: 391 TLTTPFSITSSVSSETMSNPVTVAAAMSMRSPVNVSSAVNI-TSPMNIG--HPVTITSPL 447 Query: 68 SFIIARTLTTPSGCPVSV 15 S TLTTP P V Sbjct: 448 SMTSPLTLTTPVNLPTPV 465
>FDHE_PASMU (Q9CNM2) Protein fdhE homolog| Length = 309 Score = 32.0 bits (71), Expect = 1.3 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 340 DSEIVVIKNLRVCGDCHSFLKAV 408 DSEI +K CGDCHS+LKA+ Sbjct: 244 DSEIAAVK-AESCGDCHSYLKAL 265
>ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 956 Score = 30.4 bits (67), Expect = 3.7 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 316 PQQASHCESRSTAQPSSRSTARPLCLAHFPQCHLFSPSP 200 P Q S C + +TA PSS + +A P C S SP Sbjct: 702 PLQGSFCANSNTASPSSHPSTSFASMASLPSCPAPSSSP 740
>SYK2_METAC (Q8TSN5) Lysyl-tRNA synthetase 2 (EC 6.1.1.6) (Lysine--tRNA ligase| 2) (LysRS 2) Length = 511 Score = 29.6 bits (65), Expect = 6.4 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +1 Query: 169 IYDLVIKLEQMVKEKTDGTVENGQGRV-DERYSGKMAAPLIGFHSEKLAVAFSLLNTDDS 345 I ++++K E EK +G GR+ + R GKM +G + ++ V N D Sbjct: 57 ICEILVKFEDF--EKNEGLSVRTAGRLYNIRKHGKMIFADLGDQTGRIQVLIRKGNLPDE 114 Query: 346 EIVVIKNLRVCGD 384 E KNL GD Sbjct: 115 EFATFKNLMDSGD 127
>CAPP_THES7 (P51060) Phosphoenolpyruvate carboxylase (EC 4.1.1.31) (PEPCase)| (PEPC) Length = 857 Score = 29.6 bits (65), Expect = 6.4 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +1 Query: 28 QPDGVVRVRAMMKERGLKKEPGCSYVEHKGRVHLFTADDHSHPQAKRIYDLVIKLEQMVK 207 +P+G + + +KERGL E +++ + FTA HP R L LE++ + Sbjct: 107 RPEGFLALAKALKERGLSLEEAEAHLNRLALLLTFTA----HPTETRRRTLRHHLERLQE 162 Query: 208 EKTDGTVENGQGRV 249 E G E RV Sbjct: 163 ELEGGDRERLLARV 176
>POLG_TEV (P04517) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral geno Length = 3054 Score = 29.6 bits (65), Expect = 6.4 Identities = 13/24 (54%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = +2 Query: 425 GHFLSGTR--AASIASKVEHAPAK 490 GHF+ TR AAS+AS++ H+PA+ Sbjct: 1218 GHFMEFTRDTAASVASEISHSPAR 1241
>COX10_GIBZE (Q4I5G1) Protoheme IX farnesyltransferase, mitochondrial precursor| (EC 2.5.1.-) (Heme O synthase) Length = 507 Score = 29.3 bits (64), Expect = 8.3 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +1 Query: 403 AVSAIANRAFLVRDASRFHRFEGGACSCKD-YW*RIW 510 AV++ A+L+R++ RF R+EG S + +W +W Sbjct: 412 AVTSFPINAWLIRESVRFWRYEGNKGSARGLFWASVW 448 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,493,022 Number of Sequences: 219361 Number of extensions: 1872667 Number of successful extensions: 5471 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5466 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)