| Clone Name | bags5e24 |
|---|---|
| Clone Library Name | barley_pub |
>CAC1B_DISOM (P56698) Probable voltage-dependent N-type calcium channel alpha-1B| subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (DOE-4) Length = 2326 Score = 31.2 bits (69), Expect = 2.9 Identities = 21/71 (29%), Positives = 29/71 (40%) Frame = -3 Query: 564 GSCTNQSRQSMAMYCQSSEERAMLHKASMTPEILAT*PRPSLLWQIVLSKPTPAGEFSFT 385 GS + QS + S R L + +TP RPS+ ++ S P G Sbjct: 2144 GSVNDSPLQSASGSSTPSRGRRQLPRTPLTP-------RPSVTYKTANSSPAHFGNLHDA 2196 Query: 384 SPPHIPGNLAR 352 PP PG L+R Sbjct: 2197 LPPSSPGRLSR 2207
>IF4G1_HUMAN (Q04637) Eukaryotic translation initiation factor 4 gamma 1| (eIF-4-gamma 1) (eIF-4G1) (eIF-4G 1) (p220) Length = 1600 Score = 31.2 bits (69), Expect = 2.9 Identities = 24/75 (32%), Positives = 34/75 (45%) Frame = -3 Query: 570 VPGSCTNQSRQSMAMYCQSSEERAMLHKASMTPEILAT*PRPSLLWQIVLSKPTPAGEFS 391 +PG + S+ S E ++ S P LA P L ++ LSKP P EFS Sbjct: 285 IPGDTMTTIQMSVEESTPISRETGEPYRLSPEPTPLA---EPILEVEVTLSKPVPESEFS 341 Query: 390 FTSPPHIPGNLARNS 346 +SP P LA ++ Sbjct: 342 -SSPLQAPTPLASHT 355
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 30.8 bits (68), Expect = 3.8 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 22 GGAKSCCQSFGAFGYIP*YIPCCC*SWRSA*TCNSTCLKLS 144 GG+K C S G Y PCCC S + C S+C K S Sbjct: 115 GGSKGGCGSCGC-SQCSCYKPCCCSSGCGSSCCQSSCCKPS 154
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 22 GGAKSCCQSFGAFGYIP*YIPCCC*SWRSA*TCNSTCLK 138 GG+K C S G Y PCCC S + C S+C K Sbjct: 74 GGSKGGCGSCGC-SQCSCYKPCCCSSGCGSSCCQSSCCK 111
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 22 GGAKSCCQSFGAFGYIP*YIPCCC*SWRSA*TCNSTCLK 138 GG+K C S G Y PCCC S + C S+C K Sbjct: 81 GGSKGGCGSCGC-SQCSCYKPCCCSSGCGSSCCQSSCCK 118
>ARG13_NEUCR (Q01356) Amino acid transporter arg-13| Length = 363 Score = 30.4 bits (67), Expect = 4.9 Identities = 13/53 (24%), Positives = 30/53 (56%) Frame = -3 Query: 546 SRQSMAMYCQSSEERAMLHKASMTPEILAT*PRPSLLWQIVLSKPTPAGEFSF 388 S+++ + + + ERA+L + + E++A+ RP LWQ ++ + ++F Sbjct: 226 SKETTSKWFRGRNERALLKRGASQEEVVASRERPLPLWQQAIAGASAGMSYNF 278
>NCOA2_RAT (Q9WUI9) Nuclear receptor coactivator 2 (NCoA-2) (Transcriptional| intermediary factor 2) Length = 1465 Score = 30.0 bits (66), Expect = 6.5 Identities = 21/78 (26%), Positives = 34/78 (43%) Frame = -3 Query: 453 PRPSLLWQIVLSKPTPAGEFSFTSPPHIPGNLARNSGLQISWRNSGLNAKQFMSCKDQHC 274 PR + + S P +FS H P + ++G S+ NS LNA Q +S Sbjct: 488 PRHRMSPGVAGSPRVPPSQFSPAGSLHSPAGVCSSTGNSHSYTNSSLNALQALS------ 541 Query: 273 SWLAHSSALRDSISAPPI 220 H +L S+++P + Sbjct: 542 --EGHGVSLGPSLASPDL 557 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,998,590 Number of Sequences: 219361 Number of extensions: 1782290 Number of successful extensions: 4572 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4571 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)