| Clone Name | bags4n17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ULE1B_HUMAN (Q9UBT2) Ubiquitin-like 1-activating enzyme E1B (SUM... | 30 | 5.5 | 2 | ULE1B_MOUSE (Q9Z1F9) Ubiquitin-like 1-activating enzyme E1B (SUM... | 29 | 7.2 | 3 | PTMS_HUMAN (P20962) Parathymosin | 29 | 7.2 | 4 | YAD7_YEAST (P39728) Hypothetical 30.5 kDa protein in PYK1-SNC1 i... | 29 | 9.3 |
|---|
>ULE1B_HUMAN (Q9UBT2) Ubiquitin-like 1-activating enzyme E1B (SUMO-1-activating| enzyme subunit 2) (Anthracycline-associated resistance ARX) Length = 640 Score = 29.6 bits (65), Expect = 5.5 Identities = 13/38 (34%), Positives = 26/38 (68%) Frame = +2 Query: 125 SNGADESAEPASDGAQDEHVGEQMDTDKDDPSQA*EVS 238 +NG+D+ A+P++ AQ++ +D+D++D S +VS Sbjct: 567 TNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNADVS 604
>ULE1B_MOUSE (Q9Z1F9) Ubiquitin-like 1-activating enzyme E1B (SUMO-1-activating| enzyme subunit 2) (Anthracycline-associated resistance ARX) Length = 638 Score = 29.3 bits (64), Expect = 7.2 Identities = 12/38 (31%), Positives = 26/38 (68%) Frame = +2 Query: 125 SNGADESAEPASDGAQDEHVGEQMDTDKDDPSQA*EVS 238 +NG+D+ A+P++ AQ++ +D+D++ PS + + S Sbjct: 565 ANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCS 602
>PTMS_HUMAN (P20962) Parathymosin| Length = 101 Score = 29.3 bits (64), Expect = 7.2 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 119 EQSNGADESAEPASDGAQDEHVGEQMDTDKDD 214 E+ NGA+E E ++ ++E GE+ D ++++ Sbjct: 39 EEENGAEEEEEETAEDGEEEDEGEEEDEEEEE 70
>YAD7_YEAST (P39728) Hypothetical 30.5 kDa protein in PYK1-SNC1 intergenic| region Length = 267 Score = 28.9 bits (63), Expect = 9.3 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = -2 Query: 363 LQKLSM-FYSYPHNV*KQPFLLSP*QAKSTIAQPIMDIKSPQIDTSYAWEGSSLSVSICS 187 LQKL Y P + QP LL K I + K T Y +S+ V++CS Sbjct: 16 LQKLDTNVYFGPCEILTQPILLQYENIKFIIGVNLSTEKIASFYTQYFRNSNSVVVNLCS 75 Query: 186 PTCSS*APSLA 154 PT ++ A A Sbjct: 76 PTTAAVATKKA 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,309,415 Number of Sequences: 219361 Number of extensions: 1228013 Number of successful extensions: 3145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3136 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)