| Clone Name | bags4c03 |
|---|---|
| Clone Library Name | barley_pub |
>LRP2_HUMAN (P98164) Low-density lipoprotein receptor-related protein 2 precursor| (Megalin) (Glycoprotein 330) (gp330) Length = 4655 Score = 31.2 bits (69), Expect = 2.7 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -1 Query: 489 WPFCLWVGPCDSGVPPSQQQRIQPRTMNLLGSDPKVQQVLSCPIRWSCESHYTCGD 322 W C V C S +Q + RT + +G D + + P+RW C+ CGD Sbjct: 3696 WAVCNGVDDCRDN---SDEQGCEERTCHPVG-DFRCKNHHCIPLRWQCDGQNDCGD 3747
>HEM1_BACSK (Q5WEP3) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR)| Length = 454 Score = 30.0 bits (66), Expect = 6.0 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 297 GNMARVVEGHRRYSGFRKTILLDRTK--LVELLDHFQGGSLSWVEFSAAVKEA 449 G M+ + H +G +++RTK VEL F G + S+ E + A+KEA Sbjct: 191 GKMSELTAKHLYANGAASISVMNRTKENAVELASQFAGTARSFAELNDALKEA 243
>PDZK3_RAT (Q9QZR8) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Plakophilin-related armadillo repeat protein-interacting PDZ protein) Length = 2766 Score = 30.0 bits (66), Expect = 6.0 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 6/75 (8%) Frame = +3 Query: 165 PNLVRKEKLLSPDELRPFQNHSTQMAALDYMVSIASNVFIP------SYDGNMARVVEGH 326 P+L +K+ LLS EL + H Q + D++V+ + + P S DG++ V H Sbjct: 802 PSLAKKDSLLSESELSQYFVHDGQGSLSDFVVAGSEDEDHPGSGYETSEDGSLLPVPSAH 861 Query: 327 RRYSGFRKTILLDRT 371 + + T+ RT Sbjct: 862 KARANSLVTLGSQRT 876
>UTP15_CHICK (Q5F3D7) U3 small nucleolar RNA-associated protein 15 homolog| Length = 520 Score = 29.6 bits (65), Expect = 7.8 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 441 KEAHQNRMGQPTDRRAIPGR---PKEEDYFYSNPQECL 545 KE Q + QP R + GR PK+ED+F S P C+ Sbjct: 324 KEKSQKKR-QPAYRTYVKGRNYMPKQEDFFVSKPGRCI 360
>CCHL_YEAST (P06182) Cytochrome c heme lyase (EC 4.4.1.17) (CCHL)| (Holocytochrome-C synthase) Length = 269 Score = 29.6 bits (65), Expect = 7.8 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = -1 Query: 447 PPSQQQRIQPRTMNLLGSDPKVQQVLSCPIRWSCESHYTCGDL-----QQPLPYSRHNW 286 P + + +QP+ + +G VLS RW + CG L Q LP+ RH+W Sbjct: 145 PHTDESHVQPKLLKFMGKPG----VLSPRARWM----HLCGLLFPSHFSQELPFDRHDW 195
>WDR47_MOUSE (Q8CGF6) WD-repeat protein 47| Length = 920 Score = 29.6 bits (65), Expect = 7.8 Identities = 18/75 (24%), Positives = 34/75 (45%) Frame = -1 Query: 402 LGSDPKVQQVLSCPIRWSCESHYTCGDLQQPLPYSRHNWG*KHCLLSKPCSPVLPSGSNG 223 +GS+ K +V + P + +H ++H+ G +C+ PC +L +GSN Sbjct: 624 VGSNSKTLRVCAYPEKMDASAHDNPKQPVVRFKRNKHHKGSIYCVAWSPCGQLLATGSN- 682 Query: 222 SGMAAIHREIEVFPF 178 + ++V PF Sbjct: 683 ------DKYVKVLPF 691 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,942,599 Number of Sequences: 219361 Number of extensions: 2465476 Number of successful extensions: 5851 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5851 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)