| Clone Name | bags1i07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OPHN1_MOUSE (Q99J31) Oligophrenin 1 | 35 | 0.11 | 2 | OPHN1_PONPY (Q7YQL5) Oligophrenin 1 | 34 | 0.25 | 3 | OPHN1_PANTR (Q7YQL6) Oligophrenin 1 | 34 | 0.25 | 4 | OPHN1_HUMAN (O60890) Oligophrenin 1 | 34 | 0.25 | 5 | MRGA4_MOUSE (Q91WW2) Mas-related G-protein coupled receptor memb... | 33 | 0.42 | 6 | TAGAP_HUMAN (Q8N103) T-cell activation Rho GTPase-activating pro... | 32 | 0.94 | 7 | ERG7_CANAL (Q04782) Lanosterol synthase (EC 5.4.99.7) (Oxidosqua... | 32 | 1.2 | 8 | RHG01_HUMAN (Q07960) Rho-GTPase-activating protein 1 (GTPase-act... | 31 | 2.7 | 9 | MTB_SALAL (P68502) Metallothionein B (MT-B) | 30 | 4.6 | 10 | MTB_ONCMY (P68501) Metallothionein B (MT-B) | 30 | 4.6 |
|---|
>OPHN1_MOUSE (Q99J31) Oligophrenin 1| Length = 802 Score = 35.4 bits (80), Expect = 0.11 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 279 LVTAYRTDKTK-RLDAINKVVYEVFPEPNRQLLQRILKMMMIVGSHKAVNRMSNS 440 LV+A ++D RL AI+ +VY++ PE NR++L+ ++K ++ V H N M+ S Sbjct: 469 LVSAAKSDNLDYRLGAIHSLVYKL-PEKNREMLELLIKHLVNVCEHSKENLMTPS 522
>OPHN1_PONPY (Q7YQL5) Oligophrenin 1| Length = 802 Score = 34.3 bits (77), Expect = 0.25 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 279 LVTAYRTDKTK-RLDAINKVVYEVFPEPNRQLLQRILKMMMIVGSHKAVNRMSNS 440 LV+A ++D RL AI+ +VY++ PE NR++L+ +++ ++ V H N M+ S Sbjct: 469 LVSAAKSDNLDYRLGAIHSLVYKL-PEKNREMLELLIRHLVNVCEHSKENLMTPS 522
>OPHN1_PANTR (Q7YQL6) Oligophrenin 1| Length = 802 Score = 34.3 bits (77), Expect = 0.25 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 279 LVTAYRTDKTK-RLDAINKVVYEVFPEPNRQLLQRILKMMMIVGSHKAVNRMSNS 440 LV+A ++D RL AI+ +VY++ PE NR++L+ +++ ++ V H N M+ S Sbjct: 469 LVSAAKSDNLDYRLGAIHSLVYKL-PEKNREMLELLIRHLVNVCEHSKENLMTPS 522
>OPHN1_HUMAN (O60890) Oligophrenin 1| Length = 802 Score = 34.3 bits (77), Expect = 0.25 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 279 LVTAYRTDKTK-RLDAINKVVYEVFPEPNRQLLQRILKMMMIVGSHKAVNRMSNS 440 LV+A ++D RL AI+ +VY++ PE NR++L+ +++ ++ V H N M+ S Sbjct: 469 LVSAAKSDNLDYRLGAIHSLVYKL-PEKNREMLELLIRHLVNVCEHSKENLMTPS 522
>MRGA4_MOUSE (Q91WW2) Mas-related G-protein coupled receptor member A4 (RF-amide| G-protein coupled receptor) Length = 313 Score = 33.5 bits (75), Expect = 0.42 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -1 Query: 427 LFTALCDPTIIIILRILCSNCRFGSGKTSYTTLFIASSLFVL 302 LF LC T+ ++ R+ C G GKT +T LF+ L VL Sbjct: 185 LFIVLCLSTLALLARLFC-----GGGKTKFTRLFVTIMLTVL 221
>TAGAP_HUMAN (Q8N103) T-cell activation Rho GTPase-activating protein (T-cell| activation GTPase-activating protein) Length = 731 Score = 32.3 bits (72), Expect = 0.94 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 5/99 (5%) Frame = +3 Query: 159 MKRERKSSPQKRMDMLLVTVLSVFFEXMPASPVPAACCTALVTAYR-----TDKTKRLDA 323 +K E S ++ L V +L+V F+ S + L + D+ R++A Sbjct: 134 LKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMGALEMQDEEDRIEA 193 Query: 324 INKVVYEVFPEPNRQLLQRILKMMMIVGSHKAVNRMSNS 440 + +V + P PN LL+ ++ ++ ++ + VNRM +S Sbjct: 194 LKQVA-DKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSS 231
>ERG7_CANAL (Q04782) Lanosterol synthase (EC 5.4.99.7)| (Oxidosqualene--lanosterol cyclase) (2,3-epoxysqualene--lanosterol cyclase) (OSC) Length = 728 Score = 32.0 bits (71), Expect = 1.2 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Frame = +2 Query: 140 NAXFRDYEKGKKEFSAEEDGHVIGDC----IKCIL--RXNASFA 253 + FRD KG FS +E G+ + DC +K I+ R +ASFA Sbjct: 426 DGSFRDRRKGAWPFSTKEQGYTVSDCTAEAMKAIIMVRNHASFA 469
>RHG01_HUMAN (Q07960) Rho-GTPase-activating protein 1 (GTPase-activating protein| rhoOGAP) (Rho-related small GTPase protein activator) (CDC42 GTPase-activating protein) (p50-rhoGAP) Length = 439 Score = 30.8 bits (68), Expect = 2.7 Identities = 18/79 (22%), Positives = 39/79 (49%) Frame = +3 Query: 204 LLVTVLSVFFEXMPASPVPAACCTALVTAYRTDKTKRLDAINKVVYEVFPEPNRQLLQRI 383 L +L F +P + +V D+++R+ A +V+ + PE N Q+L+ + Sbjct: 313 LPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVL-QTLPEENYQVLRFL 371 Query: 384 LKMMMIVGSHKAVNRMSNS 440 ++ + +H N+M+N+ Sbjct: 372 TAFLVQISAHSDQNKMTNT 390
>MTB_SALAL (P68502) Metallothionein B (MT-B)| Length = 60 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 79 QCFXCSLLNGKIFKCPCXPHDCLQCA 2 +C C+ + K CPC P DC +CA Sbjct: 19 KCSNCACTSCKKSCCPCCPSDCSKCA 44
>MTB_ONCMY (P68501) Metallothionein B (MT-B)| Length = 60 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 79 QCFXCSLLNGKIFKCPCXPHDCLQCA 2 +C C+ + K CPC P DC +CA Sbjct: 19 KCSNCACTSCKKSCCPCCPSDCSKCA 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,797,826 Number of Sequences: 219361 Number of extensions: 1295302 Number of successful extensions: 3286 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3286 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)