| Clone Name | bags1g17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YQ53_CAEEL (Q09249) Hypothetical protein C16C10.3 | 29 | 7.3 | 2 | NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleop... | 29 | 7.3 |
|---|
>YQ53_CAEEL (Q09249) Hypothetical protein C16C10.3| Length = 1032 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = -1 Query: 476 YFISIAHHMTYNTSSTTPLHIKVQGLTSAHQNNFTMHKRILLQVQVHRKRIQQVHNRTSR 297 YF + H ++Y S + + L +NN+ +H+R + +Q RI + H+ Sbjct: 943 YFRAFGHQVSYQPPSVPDVLYAAENLAKRGRNNYKIHQR-YVNLQAVENRIIKDHSELIN 1001 Query: 296 E 294 E Sbjct: 1002 E 1002
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 28.9 bits (63), Expect = 7.3 Identities = 20/56 (35%), Positives = 25/56 (44%) Frame = -3 Query: 426 SSTHQGSRPNKCTSK*FYNAQKNTSASASA*KEDPTSAQSHIKRVLQRLDEKHKFL 259 S+ H S P CT + A+ A E P S + HIKR+LQR FL Sbjct: 497 STVHPASPPLLCTQEDAEVAESPLRILA----ETPDSFEKHIKRILQRSAANPAFL 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,648,346 Number of Sequences: 219361 Number of extensions: 1305893 Number of successful extensions: 3715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3711 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)