| Clone Name | bags1e22 |
|---|---|
| Clone Library Name | barley_pub |
>YIOR_CVTKE (P26626) Hypothetical protein in nucleocapsid ORF (IORF)| Length = 207 Score = 30.4 bits (67), Expect = 3.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 15 NLSLRRGEAALIHFEASNYVLQGTGRINTDVPLTLSLPKXEWSCH 149 +L+L+R + L+H E+ L+GTG TDV L + CH Sbjct: 57 SLNLQRDKVCLLHQESQLLKLRGTGTDTTDVLLKQPMATSVNCCH 101
>YIOR_CVBM (P10525) Hypothetical protein in nucleocapsid ORF (IORF)| Length = 207 Score = 30.4 bits (67), Expect = 3.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 15 NLSLRRGEAALIHFEASNYVLQGTGRINTDVPLTLSLPKXEWSCH 149 +L+L+R + L+H E+ L+GTG TDV L + CH Sbjct: 57 SLNLQRDKVCLLHQESQLLKLRGTGTDTTDVLLKQPMATSVNCCH 101
>YIOR_CVBF (P22654) Hypothetical protein in nucleocapsid ORF (IORF)| Length = 207 Score = 29.6 bits (65), Expect = 5.5 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 15 NLSLRRGEAALIHFEASNYVLQGTGRINTDVPLTLSLPKXEWSCH 149 +L+L R + L+H E+ L+GTG TDV L ++ CH Sbjct: 57 SLNLLRDKVCLLHQESQLLKLRGTGTDTTDVLLKHAMATSVNCCH 101
>Y2585_BACHD (Q9K9R0) UPF0348 protein BH2585| Length = 416 Score = 28.9 bits (63), Expect = 9.3 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 24 LRRGEAALI-HFEASNYVLQGTGRINTDVPLTLSLPKXEW 140 L+RGE A++ +E ++ LQG + ++P S K EW Sbjct: 42 LQRGEPAILPKWERTSLALQGGADLVVELPYAFSTQKAEW 81
>B3A3_RAT (P23348) Anion exchange protein 3 (Neuronal band 3-like protein)| (Solute carrier family 4 member 3) Length = 1227 Score = 28.9 bits (63), Expect = 9.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 241 SKLFFKQATSWQPCAASDLMISVSSELSLRNPSPSARVP 357 S++ +++ W P A+ DL + +L NP P RVP Sbjct: 213 SRISTEKSRPWSPSASYDLRERLCPGSALGNPGPEQRVP 251
>B3A3_MOUSE (P16283) Anion exchange protein 3 (Neuronal band 3-like protein)| (Solute carrier family 4 member 3) Length = 1227 Score = 28.9 bits (63), Expect = 9.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 241 SKLFFKQATSWQPCAASDLMISVSSELSLRNPSPSARVP 357 S++ +++ W P A+ DL + +L NP P RVP Sbjct: 213 SRISTEKSRPWSPSASYDLRERLCPGSALGNPGPEQRVP 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,662,210 Number of Sequences: 219361 Number of extensions: 1166892 Number of successful extensions: 2299 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2299 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)