| Clone Name | bags1d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VC09_VACCV (P17372) Ankyrin repeat protein C9 | 30 | 5.7 | 2 | VC09_VACCC (P21042) Ankyrin repeat protein C9 | 30 | 5.7 | 3 | SEC17_NEUCR (Q9P6A5) Probable vesicular-fusion protein sec17 hom... | 29 | 9.8 | 4 | PAPPA_MOUSE (Q8R4K8) Pappalysin-1 precursor (EC 3.4.24.79) (Preg... | 29 | 9.8 |
|---|
>VC09_VACCV (P17372) Ankyrin repeat protein C9| Length = 634 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 499 HRDPKIVEFIVNNSS--IDHQENDLLPGLCKLLETWLVSEV 615 +RDPK+VE+I+ N + +D+ +D L + L T+ + E+ Sbjct: 350 NRDPKVVEYILKNGNLVVDNDNDDNLINIMPLFPTFSMREL 390
>VC09_VACCC (P21042) Ankyrin repeat protein C9| Length = 634 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +1 Query: 499 HRDPKIVEFIVNNSS--IDHQENDLLPGLCKLLETWLVSEV 615 +RDPK+VE+I+ N + +D+ +D L + L T+ + E+ Sbjct: 350 NRDPKVVEYILKNGNLVVDNDNDDNLINIMPLFPTFSMREL 390
>SEC17_NEUCR (Q9P6A5) Probable vesicular-fusion protein sec17 homolog| Length = 292 Score = 29.3 bits (64), Expect = 9.8 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%) Frame = +1 Query: 256 EWFEIY-SVALANVAQAIVSKRPELIMVADDLFEQLQKFNIGSQYAYGNEM------DLA 414 EW+E +VALAN + K +L +A D F ++KF ++ + GN + + Sbjct: 146 EWYENDGAVALAN---KLWLKVADLSALAGDFFAAIEKFEKVAEASLGNNLMRYSVKEYF 202 Query: 415 LERALCSLLVGDI 453 L+ LCSL D+ Sbjct: 203 LKAGLCSLATKDM 215
>PAPPA_MOUSE (Q8R4K8) Pappalysin-1 precursor (EC 3.4.24.79)| (Pregnancy-associated plasma protein-A) (PAPP-A) (Insulin-like growth factor-dependent IGF-binding protein 4 protease) (IGF-dependent IGFBP-4 protease) (IGFBP-4ase) Length = 1624 Score = 29.3 bits (64), Expect = 9.8 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 388 AYGNEMDLALERALCSLLVGDISNCRTWLAIDNESSPHRDPKIVEFIVNNSSIDHQEN 561 A+G +D LE LC + D + ++ N+ R PK+V + V N DH EN Sbjct: 310 AHGFLLDTNLEPPLCGQTLCDNTEV---ISSYNQLPSFRQPKVVRYRVVNIYDDHHEN 364 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,093,191 Number of Sequences: 219361 Number of extensions: 1513318 Number of successful extensions: 4591 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4590 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)