| Clone Name | basdp23 |
|---|---|
| Clone Library Name | barley_pub |
>ZCH10_RAT (Q5EB97) Zinc finger CCHC domain-containing protein 10| Length = 173 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +1 Query: 217 QKCFQPGHWTYECKNERVYISRPSRTDQLK 306 QKC + GHWTYECK +R Y+ RPSRT +LK Sbjct: 24 QKCLEFGHWTYECKGKRKYLHRPSRTAELK 53
>ZCH10_MOUSE (Q9CX48) Zinc finger CCHC domain-containing protein 10| Length = 178 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = +1 Query: 217 QKCFQPGHWTYECKNERVYISRPSRTDQLK 306 QKC + GHWTYECK +R Y+ RPSRT +LK Sbjct: 24 QKCLEFGHWTYECKGKRKYLHRPSRTAELK 53
>ZCH10_HUMAN (Q8TBK6) Zinc finger CCHC domain-containing protein 10| Length = 192 Score = 48.5 bits (114), Expect = 9e-06 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +1 Query: 217 QKCFQPGHWTYECKNERVYISRPSRTDQLK 306 QKC + GHWTYEC +R Y+ RPSRT +LK Sbjct: 46 QKCLEFGHWTYECTGKRKYLHRPSRTAELK 75
>CBLB_RAT (Q8K4S7) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) Length = 938 Score = 32.0 bits (71), Expect = 0.83 Identities = 22/51 (43%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -3 Query: 208 PQQLQKLVQHLVSHPASQPSRYSSDTSASWLPSSP----ASGLVPLPSAHR 68 P L++H S P SR SS LPS P ASG VPLP A R Sbjct: 782 PPARHSLIEH--SKPPGSSSRPSSGQDLFLLPSDPFFDPASGQVPLPPARR 830
>CBLB_HUMAN (Q13191) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) Length = 982 Score = 32.0 bits (71), Expect = 0.83 Identities = 22/51 (43%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = -3 Query: 208 PQQLQKLVQHLVSHPASQPSRYSSDTSASWLPSSP----ASGLVPLPSAHR 68 P L++H S P SR SS LPS P ASG VPLP A R Sbjct: 826 PPARHSLIEH--SKPPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARR 874
>GOGA5_ARATH (Q8S8N9) Golgin-84| Length = 707 Score = 31.2 bits (69), Expect = 1.4 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -3 Query: 202 QLQKLVQHLVSHPAS---QPSRYSSDTSASWLPSSPASGLVPLPSAHRH 65 QL+K V+ L H A + SR S SA+W S L PLP HRH Sbjct: 588 QLEKEVKRL--HEAQVEVEKSRVSRRASATWEEDSEIKTLEPLPLYHRH 634
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +1 Query: 115 EAKRQMYLMSTEKAVRLGVRPNAEPASATAGGQFQKCFQPGHWTYECKNER 267 E + + Y S+ R G R ++ S + C QPGH+ +C N R Sbjct: 199 EGRGRSYQRSSNNYGRSGARGKSKNRSKSRVRNCYNCNQPGHFKRDCPNPR 249
>NED4L_PONPY (Q5RBF2) E3 ubiquitin-protein ligase NEDD4-like protein (EC| 6.3.2.-) Length = 959 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 91 PSRWQERKEAKRQMYLMSTEKAVRLGVRPNAEPASATAGG 210 PS W+ERK+AK + Y ++ RP + A A G Sbjct: 372 PSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASG 411
>NED4L_MOUSE (Q8CFI0) E3 ubiquitin-protein ligase NEDD4-like protein (EC| 6.3.2.-) (Nedd4-2) (NEDD4.2) Length = 1004 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 91 PSRWQERKEAKRQMYLMSTEKAVRLGVRPNAEPASATAGG 210 PS W+ERK+AK + Y ++ RP + A A G Sbjct: 417 PSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASG 456
>NED4L_HUMAN (Q96PU5) E3 ubiquitin-protein ligase NEDD4-like protein (EC| 6.3.2.-) (Nedd4-2) (NEDD4.2) Length = 975 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 91 PSRWQERKEAKRQMYLMSTEKAVRLGVRPNAEPASATAGG 210 PS W+ERK+AK + Y ++ RP + A A G Sbjct: 388 PSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASG 427
>TTLL7_HUMAN (Q6ZT98) Tubulin--tyrosine ligase-like protein 7 (Protein NYD-SP30)| Length = 887 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = -3 Query: 259 SCTRMSSAQAGSTSEIGPQQLQKLVQHLVSHPASQPSRYSSDTSASWLPSSPAS 98 SC R SAQ+ S+ + P Q+++ VS P S +S + ++S++ P S Sbjct: 603 SCPRSISAQSPSSGDTRPFSAQQMIS--VSRPTSASRSHSLNRASSYMRHLPHS 654
>NEUM_MOUSE (P06837) Neuromodulin (Axonal membrane protein GAP-43)| (Growth-associated protein 43) (Calmodulin-binding protein P-57) Length = 227 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 279 AALEDGPA*GPKAEEGVAAGSLPVREP*SGEGDGGRKE 392 A + PA PKAEE AG P E GEGD E Sbjct: 87 ATTDAAPATSPKAEEPSKAGDAPSEEK-KGEGDAAPSE 123
>RPOC1_CUCSA (Q4VZP2) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 680 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 82 EEGPS--RWQERKEAKRQMYLMSTEKAVRLGVRPNAEP 189 EEGP+ W++RK +R+ +L+ + + +R N EP Sbjct: 224 EEGPAGNEWEDRKVGRRKDFLVRRMELAKHFIRTNIEP 261
>ACDS_MEGEL (Q06319) Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)| (SCAD) (Butyryl-CoA dehydrogenase) (BCAD) Length = 383 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +1 Query: 100 WQERKEAKRQMYLMSTEKAVRLGVRPNAEPASAT-AGGQFQKCFQPGHWTYECKNERVYI 276 WQ EA+++ +L+ + +LG EP + T A GQ + TY +++I Sbjct: 102 WQFGTEAQKEKFLVPLVEGTKLGAFGLTEPNAGTDASGQQTIATKNDDGTYTLNGSKIFI 161 Query: 277 SRPSRTD 297 + D Sbjct: 162 TNGGAAD 168
>VE2_BPV2 (P11299) Regulatory protein E2| Length = 411 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -3 Query: 166 PASQPSRYSSDTSASWL--PSSPASGLVPLPSAHRH*HCERQLPLHVQLEPCSIP*H 2 P P + + + S L S+P G VP+ A R E Q P + EP ++P H Sbjct: 256 PRPHPYHFPAGSGGSLLRSASTPVQGPVPVDLAPRQEEEENQSPDSTEEEPVTVPRH 312
>UROK_PAPCY (P16227) Urokinase-type plasminogen activator precursor (EC| 3.4.21.73) (uPA) (U-plasminogen activator) [Contains: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen Length = 433 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 259 SCTRMSSAQAGSTSEIGPQQLQKLVQHLVSH-PASQPSRYSSDTSASWL 116 SC + ST + P+QL+ V LVSH QP Y S+ + L Sbjct: 314 SCEITGFGKENSTDYLYPEQLKMTVVKLVSHQKCQQPHYYGSEVTTKML 362
>NEUM_RAT (P07936) Neuromodulin (Axonal membrane protein GAP-43)| (Growth-associated protein 43) (Protein F1) Length = 226 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 279 AALEDGPA*GPKAEEGVAAGSLPVREP*SGEGDGGRKE 392 A + PA PKAEE AG P E GEGD E Sbjct: 87 ATTDAAPATSPKAEEPSKAGDAPSEEK-KGEGDAAPSE 123
>ZEA6_MAIZE (P04702) Zein-alpha precursor (19 kDa) (Clone M6)| Length = 240 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 208 PQQLQKLVQHLVSHPASQPSRYSSDTSASWLPSSP 104 P L ++ + +PA QP R +AS +PSSP Sbjct: 37 PPYLPSIIASICENPALQPYRLQQAIAASNIPSSP 71
>UROK_HUMAN (P00749) Urokinase-type plasminogen activator precursor (EC| 3.4.21.73) (uPA) (U-plasminogen activator) [Contains: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen Length = 431 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 259 SCTRMSSAQAGSTSEIGPQQLQKLVQHLVSH-PASQPSRYSSDTSASWL 116 SC + ST + P+QL+ V L+SH QP Y S+ + L Sbjct: 312 SCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML 360
>RPOC1_SINAL (P46819) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 688 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 82 EEGPS--RWQERKEAKRQMYLMSTEKAVRLGVRPNAEP 189 EEGP+ W++RK +R+ +L+ + + +R N EP Sbjct: 232 EEGPTGNEWEDRKIVRRKDFLVRRMELAKHFIRTNIEP 269
>RPOC1_ARATH (P56763) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta' subunit) (RNA polymerase beta' subunit) Length = 680 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 82 EEGPS--RWQERKEAKRQMYLMSTEKAVRLGVRPNAEP 189 EEGP+ W++RK +R+ +L+ + + +R N EP Sbjct: 224 EEGPTGNEWEDRKIVRRKDFLVRRMELAKHFIRTNIEP 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.129 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,734,820 Number of Sequences: 219361 Number of extensions: 1116251 Number of successful extensions: 3062 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3062 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)