| Clone Name | basdl01 |
|---|---|
| Clone Library Name | barley_pub |
>AROG_LYCES (P37216) Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplast| precursor (EC 2.5.1.54) (Phospho-2-keto-3-deoxyheptonate aldolase 2) (DAHP synthetase 2) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2) Length = 541 Score = 31.6 bits (70), Expect = 2.0 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -3 Query: 230 TAHHCVLLPPFHNISLFRDSTRGLHTDVYRHTL 132 T+H C+LLP +++ RDST GLH D H L Sbjct: 316 TSHECLLLPYEQSLTR-RDSTSGLHYDCSAHFL 347
>POLG_BCMVN (Q65399) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3066 Score = 30.4 bits (67), Expect = 4.5 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Frame = +1 Query: 340 AWLSK*MPLWRLVSLRRVTSEFCRRRVCSGRALTGRQ-VSG*TDSLYNKMQNA-LVIAIF 513 +WL K W+L +VT E ++ GR + R+ VS + + NA + I+ Sbjct: 941 SWLEKSSVTWQLKKFSKVTEEHLTKKAAEGRKESSRKFVSACFMNAQTHLGNARITISNK 1000 Query: 514 GCEITTLYLERIIE 555 E+T L + RI+E Sbjct: 1001 VNEVTNLGVRRIVE 1014
>AROF_ARATH (P29976) Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast| precursor (EC 2.5.1.54) (Phospho-2-keto-3-deoxyheptonate aldolase 1) (DAHP synthetase 1) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1) Length = 525 Score = 29.3 bits (64), Expect = 10.0 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 230 TAHHCVLLPPFHNISLFR-DSTRGLHTDVYRHTLEC 126 T+H C+LLP + SL R DST GL+ D H + C Sbjct: 302 TSHECLLLP--YEQSLTRLDSTSGLYYDCSAHMVWC 335
>AROF_SOLTU (P21357) Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast| precursor (EC 2.5.1.54) (Phospho-2-keto-3-deoxyheptonate aldolase 1) (DAHP synthetase 1) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1) Length = 538 Score = 29.3 bits (64), Expect = 10.0 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 230 TAHHCVLLPPFHNISLFRDSTRGLHTDVYRHTL 132 T+H C+LLP +++ RDST GL+ D H L Sbjct: 316 TSHECLLLPYEQSLTR-RDSTSGLYYDCSAHFL 347
>SO1A4_RAT (O35913) Solute carrier organic anion transporter family member 1A4| (Solute carrier family 21 member 5) (Sodium-independent organic anion-transporting polypeptide 2) (Brain digoxin carrier protein) (Brain-specific organic anion transporter) (OA Length = 661 Score = 29.3 bits (64), Expect = 10.0 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 7/37 (18%) Frame = +1 Query: 478 NKMQNALVIAIFGCEITTL-------YLERIIEGEEK 567 NK+Q L+IAIFGC I +L L R I+ EEK Sbjct: 507 NKLQYFLIIAIFGCFIYSLAGIPGYMVLLRCIKSEEK 543 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,376,469 Number of Sequences: 219361 Number of extensions: 1437111 Number of successful extensions: 2627 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2627 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)