| Clone Name | bah63p09 |
|---|---|
| Clone Library Name | barley_pub |
>QCRB_MYCLE (P15878) Ubiquinol-cytochrome c reductase cytochrome b subunit| Length = 551 Score = 31.6 bits (70), Expect = 1.8 Identities = 23/78 (29%), Positives = 40/78 (51%) Frame = +2 Query: 293 PLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGSQPPPVPVRVYTDDEIAARAVMRD 472 P+WV +++A V ++ Y + + +TG Y ++ +P VPVR I A A+ Sbjct: 334 PVWVAVIMALVFVLLI-TYPFLEKRFTGDYAHHNLLQRPRDVPVRT----SIGAMAITFY 388 Query: 473 IVLSPPVHSKNPKIAFMF 526 +VL+ + + N IA F Sbjct: 389 MVLT--LAAMNDIIALKF 404
>QCRB_MYCTU (P63885) Ubiquinol-cytochrome c reductase cytochrome b subunit| Length = 549 Score = 31.2 bits (69), Expect = 2.3 Identities = 23/78 (29%), Positives = 40/78 (51%) Frame = +2 Query: 293 PLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGSQPPPVPVRVYTDDEIAARAVMRD 472 P+WV +++ V ++ AY + + +TG Y ++ +P VPVR I A A+ Sbjct: 335 PVWVAVIMGLVFVLLP-AYPFLEKRFTGDYAHHNLLQRPRDVPVRT----AIGAMAIAFY 389 Query: 473 IVLSPPVHSKNPKIAFMF 526 +VL+ + + N IA F Sbjct: 390 MVLT--LAAMNDIIALKF 405
>QCRB_MYCBO (P63886) Ubiquinol-cytochrome c reductase cytochrome b subunit| Length = 549 Score = 31.2 bits (69), Expect = 2.3 Identities = 23/78 (29%), Positives = 40/78 (51%) Frame = +2 Query: 293 PLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGSQPPPVPVRVYTDDEIAARAVMRD 472 P+WV +++ V ++ AY + + +TG Y ++ +P VPVR I A A+ Sbjct: 335 PVWVAVIMGLVFVLLP-AYPFLEKRFTGDYAHHNLLQRPRDVPVRT----AIGAMAIAFY 389 Query: 473 IVLSPPVHSKNPKIAFMF 526 +VL+ + + N IA F Sbjct: 390 MVLT--LAAMNDIIALKF 405
>MTR1A_PHOSU (P49217) Melatonin receptor type 1A (Mel-1A-R) (Mel1a melatonin| receptor) Length = 353 Score = 30.8 bits (68), Expect = 3.0 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +2 Query: 230 LCHCYTYTWIMAPRNRTSSRRPLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGS 403 +CH Y + + +N +WV+ L+A + + TG Y P+ Y+ C + S S Sbjct: 132 ICHSLKYDRLYSNKNSLCYVFLIWVLTLVAIMPNLQTGTLQYDPRIYS-CTFTQSVSS 188
>MTR1A_MOUSE (Q61184) Melatonin receptor type 1A (Mel-1A-R) (Mel1a melatonin| receptor) Length = 353 Score = 30.8 bits (68), Expect = 3.0 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +2 Query: 230 LCHCYTYTWIMAPRNRTSSRRPLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGS 403 +CH Y I + +N +W++ LIA + + TG Y P+ Y+ C + S S Sbjct: 132 ICHSLKYDKIYSNKNSLCYVFLIWMLTLIAIMPNLQTGTLQYDPRIYS-CTFTQSVSS 188
>FBN2_MOUSE (Q61555) Fibrillin-2 precursor| Length = 2907 Score = 30.8 bits (68), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Frame = +2 Query: 320 FVCAIVTGAYLYK-----PQHYTGCYLSNSCGSQP 409 F+C G + K QH+T C +N CGSQP Sbjct: 2538 FLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQP 2572
>IL4RA_HUMAN (P24394) Interleukin-4 receptor alpha chain precursor (IL-4R-alpha)| (CD124 antigen) [Contains: Soluble interleukin-4 receptor alpha chain (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)] Length = 825 Score = 30.8 bits (68), Expect = 3.0 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 28 SPPTFLPRRPDRSPEASPLPAIRSRGELAPGEIRRLNSRFS*FQQFYGN 174 SPPT R PD SP PL A LAP I + S F GN Sbjct: 753 SPPTTPLRAPDPSPGGVPLEASLCPASLAPSGISEKSKSSSSFHPAPGN 801
>LT4R2_MOUSE (Q9JJL9) Leukotriene B4 receptor 2 (LTB4-R2) (Leukotriene B4| receptor BLT2) Length = 360 Score = 30.8 bits (68), Expect = 3.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 110 SSPRLRIAGRGEASGDLSGRRGRKVGGDSGSW 15 ++P+L++ G+G +GD G G K DS W Sbjct: 329 TTPKLKVMGQGRGNGDPGGGDGGKTEKDSQEW 360
>FBN2_HUMAN (P35556) Fibrillin-2 precursor| Length = 2911 Score = 30.8 bits (68), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Frame = +2 Query: 320 FVCAIVTGAYLYK-----PQHYTGCYLSNSCGSQP 409 F+C G + K QH+T C +N CGSQP Sbjct: 2544 FLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQP 2578
>MTR1A_CHICK (P49285) Melatonin receptor type 1A (MEL-1A-R) (CKA)| Length = 353 Score = 30.4 bits (67), Expect = 4.0 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +2 Query: 230 LCHCYTYTWIMAPRNRTSSRRPLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGS 403 +CH Y + + +N +WV+ ++A V + G+ Y P+ Y+ C + S S Sbjct: 132 ICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYS-CTFAQSVSS 188
>MTR1A_RAT (P49218) Melatonin receptor type 1A (Mel-1A-R) (Mel1a melatonin| receptor) (Fragment) Length = 156 Score = 30.4 bits (67), Expect = 4.0 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 230 LCHCYTYTWIMAPRNRTSSRRPLWVIILIAFVCAIVTGAYLYKPQHYTGCYLSNSCGS 403 +CH Y I + +N +W + LIA + + TG Y P+ Y+ C + S S Sbjct: 3 ICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYS-CTFTQSVSS 59
>RNC_HUMAN (Q9NRR4) Ribonuclease III (EC 3.1.26.3) (RNase III) (Drosha) (p241)| Length = 1374 Score = 29.6 bits (65), Expect = 6.7 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 1 APHSAQEPESPPTFLPRRPDRSPEASPLPAIRSRGELAPGEIR 129 AP + P FLP RPD P P+P ++G L P IR Sbjct: 58 APSTTFSNSPAPNFLPPRPDFVPFPPPMPP-SAQGPLPPCPIR 99
>ENV_VILV (P03379) Env polyprotein (Coat polyprotein) [Contains: Leader| peptide; Exterior membrane glycoprotein; Transmembrane glycoprotein] Length = 982 Score = 29.3 bits (64), Expect = 8.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 485 GTEQCLSLQHERRSHHRCIL 426 GT C SL+HERR+ HR + Sbjct: 890 GTNGCASLEHERRTSHRSFI 909
>BWR1B_HUMAN (Q8N1D0) Beckwith-Wiedemann syndrome chromosome region 1 candidate| protein B (p27-Beckwith-Wiedemann region 1 B) (p27-BWR1B) (Organic cation transporter-like protein 2-antisense) (Solute carrier family 22 member 18 antisense) (Solute carrier Length = 253 Score = 29.3 bits (64), Expect = 8.8 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +2 Query: 143 GFRSFNNSTGMMF*HDYTSEEAL*M*ILKLCHCYTYTWIMAPRNRTSSRRPLW 301 G R S+G+ F D SEE + +LK C W +P S +W Sbjct: 74 GGRKGFGSSGLRFGRDGFSEEVMPQPVLKAMRCAEGAWWFSPDGPAGSAASIW 126
>KLKB1_HUMAN (P03952) Plasma kallikrein precursor (EC 3.4.21.34) (Plasma| prekallikrein) (Kininogenin) (Fletcher factor) [Contains: Plasma kallikrein heavy chain; Plasma kallikrein light chain] Length = 638 Score = 29.3 bits (64), Expect = 8.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 116 GASSPRLRIAGRGEASGDLSGRRGRKVGGDSGSWAEW 6 G+S LR+ G+ S + R VGG + SW EW Sbjct: 366 GSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEW 402
>ENV_VILV2 (P23423) Env polyprotein (Coat polyprotein) [Contains: Leader| peptide; Exterior membrane glycoprotein; Transmembrane glycoprotein] Length = 991 Score = 29.3 bits (64), Expect = 8.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 485 GTEQCLSLQHERRSHHRCIL 426 GT C SL+HERR+ HR + Sbjct: 899 GTNGCASLEHERRTSHRSFI 918
>RFX1_HUMAN (P22670) MHC class II regulatory factor RFX1 (RFX) (Enhancer| factor C) (EF-C) Length = 979 Score = 29.3 bits (64), Expect = 8.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 1 APHSAQEPESPPTFLPRRPDRSPEASPLP 87 AP +Q P++PP P+ P P A+P P Sbjct: 12 APPPSQPPQAPPQAQPQPPPPPPPAAPQP 40
>RFX1_MOUSE (P48377) DNA-binding protein RFX1| Length = 963 Score = 29.3 bits (64), Expect = 8.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 1 APHSAQEPESPPTFLPRRPDRSPEASPLP 87 AP ++Q P++PP LP+ P P A+P P Sbjct: 13 APQASQPPQAPPQALPQPP---PPAAPQP 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,948,255 Number of Sequences: 219361 Number of extensions: 1703065 Number of successful extensions: 6034 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 5619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6022 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)