| Clone Name | bah63n05 |
|---|---|
| Clone Library Name | barley_pub |
>GP153_MOUSE (Q8K0Z9) Probable G-protein coupled receptor 153 (G-protein coupled| receptor PGR1) Length = 631 Score = 30.4 bits (67), Expect = 3.9 Identities = 22/81 (27%), Positives = 34/81 (41%) Frame = +3 Query: 30 PASRPAAQRLFVAVAAPSRWRSIEPHRALRRSEGSRVLTMVRRCSSAGDSRAAGDGSLSS 209 PA+R +A+ V R + + RA R G ++ G AAG GS+SS Sbjct: 549 PAARDSAEPAEVPTPPGGRTQRSQGRRAARTHVGPLQSSLSASWGEPGGLHAAGCGSISS 608 Query: 210 FCIIEGPETIQDFVQMQSQEI 272 F + P +V + S + Sbjct: 609 F--LSSPSESSGYVTLHSDSL 627
>NCBP1_HUMAN (Q09161) Nuclear cap-binding protein subunit 1 (80 kDa nuclear| cap-binding protein) (NCBP 80 kDa subunit) (CBP80) Length = 790 Score = 29.6 bits (65), Expect = 6.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 467 QIELLHCLW*RIRQKRNGRWHLRHLI 390 Q E L CLW +I++ + RW RH++ Sbjct: 225 QEEYLDCLWAQIQKLKKDRWQERHIL 250
>AGLA_RHIME (Q9Z3R8) Probable alpha-glucosidase (EC 3.2.1.20)| Length = 551 Score = 29.6 bits (65), Expect = 6.6 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 461 LFDIILFHIWDNHFWWLDSPNT*TEIRAWWYL 556 + D++L H D H W+++S ++ + +A WY+ Sbjct: 108 MIDLVLSHTSDRHPWFVESRSSRSNAKADWYV 139
>ANFC3_FUGRU (Q805D4) C-type natriuretic peptide 3 precursor| Length = 158 Score = 29.3 bits (64), Expect = 8.6 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 222 EGPETIQDFVQMQSQEIQDNIKSRRSKIFLLMEEVRRLRVQQRIRTAE 365 E E +Q+ VQ Q +E+Q+ ++ ++ ++ EEV+ + +Q+ E Sbjct: 42 EMQEEVQEKVQEQQEEVQEKVQEQQEEVQEQQEEVQEQQEEQQEEVQE 89
>ZN342_HUMAN (Q8WUU4) Zinc finger protein 342| Length = 475 Score = 29.3 bits (64), Expect = 8.6 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 7/70 (10%) Frame = +1 Query: 262 HRRFKTTSRVGAAKYSF*WKRSDDYGCSSESEL-----LKADVPAVKKMRCRRCHLPF-- 420 HRR T R ++ +Y C+ S+L + P + C CH+PF Sbjct: 404 HRRSHTGERPYTCEFC-------NYACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGL 456 Query: 421 RFCLIRHQRQ 450 R L +H RQ Sbjct: 457 RATLDKHLRQ 466
>DMP1_MOUSE (O55188) Dentin matrix acidic phosphoprotein 1 precursor (Dentin| matrix protein 1) (DMP-1) (AG1) Length = 503 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 233 DNTRLRSDAITGDSRQHQESAQQNIPFNGRGQTTTG 340 D+ R DA GDS QH ES +Q + GQ++ G Sbjct: 167 DDAHSRPDA--GDSAQHSESEEQRVGGGSEGQSSHG 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,165,279 Number of Sequences: 219361 Number of extensions: 1379838 Number of successful extensions: 4246 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4244 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)