| Clone Name | baalp06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NKX32_MOUSE (P97503) Homeobox protein Nkx-3.2 (Bagpipe homeobox ... | 31 | 3.6 | 2 | RDRP_BDV (P52639) Large structural protein (L protein) (P180) [I... | 30 | 6.1 | 3 | SVP2_MOUSE (P18419) Seminal vesicle protein 2 precursor (Seminal... | 30 | 6.1 | 4 | TBX22_MOUSE (Q8K402) T-box transcription factor TBX22 (T-box pro... | 30 | 7.9 | 5 | CLSPN_MOUSE (Q80YR7) Claspin | 30 | 7.9 |
|---|
>NKX32_MOUSE (P97503) Homeobox protein Nkx-3.2 (Bagpipe homeobox protein homolog| 1) Length = 333 Score = 30.8 bits (68), Expect = 3.6 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 5/112 (4%) Frame = -2 Query: 614 LREANYGKQRCQNYLQTNRAAQEHEQVSTGVHSNSMNPTRSFV--FIFRSIGEANSQEAG 441 L E N G++RC + + + + ++P + RS E ++ +G Sbjct: 97 LSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHPAKDLEEEAPVRSDSEMSASVSG 156 Query: 440 NSA---SDRKISTGGSRIWG*HQAAEMNNSGGVLAPHGAVQQPSLTNPGRKR 294 + + D ++ GG+R+ G AA SGG ++P+ P +KR Sbjct: 157 DHSPRGEDDSVTPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKR 208
>RDRP_BDV (P52639) Large structural protein (L protein) (P180) [Includes:| RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 1711 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 257 SCGFYGREVALRGASFPDWLSLV 325 +C R V LR A +PDWLSLV Sbjct: 838 TCSLVNRVVKLRIAPYPDWLSLV 860
>SVP2_MOUSE (P18419) Seminal vesicle protein 2 precursor (Seminal vesicle| secretory protein IV) (SVS IV) Length = 113 Score = 30.0 bits (66), Expect = 6.1 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = -2 Query: 629 TLRLPLREANYGKQRCQNYLQTNRAAQEHEQVSTGVHSNSMNPTRSFVFIFRSIGEANSQ 450 +L L L GK+ + +LQ+ +E + + H + + FV SIG+ S+ Sbjct: 10 SLLLLLVTGAIGKKTKEKFLQSEETVRESFSMGSRGHMSRSSEPEVFVRPQDSIGDEASE 69 Query: 449 EAGNSASDRKIS 414 E +S+S R+ S Sbjct: 70 EMSSSSSSRRRS 81
>TBX22_MOUSE (Q8K402) T-box transcription factor TBX22 (T-box protein 22)| Length = 517 Score = 29.6 bits (65), Expect = 7.9 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 5/78 (6%) Frame = -2 Query: 611 REANYGKQRCQNYLQTNRAAQEHEQVSTGVHSNSMNPTR-----SFVFIFRSIGEANSQE 447 R+A ++ Q LQ + +E E++ +S P + S +F E+NSQE Sbjct: 22 RKAQDPREEMQPELQEEQFVEEGEEILRSPSRDSQQPEKRLKAESSKTVFSCSDESNSQE 81 Query: 446 AGNSASDRKISTGGSRIW 393 + S ++ GS +W Sbjct: 82 SLQEESVIQVELQGSDLW 99
>CLSPN_MOUSE (Q80YR7) Claspin| Length = 1315 Score = 29.6 bits (65), Expect = 7.9 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = -3 Query: 598 TASSDARTTCKQ-TEQHKNMNKSVLVCTATP*IQHEASFLFSDQSVKQ----IRKKQETA 434 T + D + T K+ T+ ++ KSV +C P LF D S K +K ET Sbjct: 666 TETKDEKETDKENTDTSSDIGKSVALCVPKPLSSDSTLLLFKDSSSKMGYFPTEEKSETD 725 Query: 433 HRIARSQQEDLEFGDDT 383 +A+ Q + L+ D + Sbjct: 726 EHLAK-QSDKLDEDDSS 741 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,222,251 Number of Sequences: 219361 Number of extensions: 1708005 Number of successful extensions: 4423 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4421 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)