| Clone Name | baalo10 |
|---|---|
| Clone Library Name | barley_pub |
>SYG_ARCFU (O29346) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 570 Score = 30.0 bits (66), Expect = 4.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 153 GFIQLRQFVYFTDSFFFHAGSRQYDHFPIY 242 G I+LR+F FF H G +++ HF +Y Sbjct: 199 GVIRLREFNQAELEFFVHPGEKKHPHFSLY 228
>IRPL2_MOUSE (Q9ERS6) X-linked interleukin-1 receptor accessory protein-like 2| precursor (IL1RAPL-2-related protein) (TIGIRR-1) Length = 686 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 507 KVYRCMKLNRNNIVIYQEIHVSYGSNYTCNWK 412 K++R + + + N ++ QE+ G NYTC K Sbjct: 186 KMWRSIIIQKGNALLIQEVQEEDGGNYTCELK 217
>IRPL2_HUMAN (Q9NP60) X-linked interleukin-1 receptor accessory protein-like 2| precursor (IL1RAPL-2-related protein) (Interleukin-1 receptor 9) (IL-1R9) (IL-1 receptor accessory protein-like 2) (Three immunoglobulin domain-containing IL-1 receptor-related Length = 686 Score = 29.6 bits (65), Expect = 5.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 507 KVYRCMKLNRNNIVIYQEIHVSYGSNYTCNWK 412 K++R + + + N ++ QE+ G NYTC K Sbjct: 186 KMWRSIIIQKGNALLIQEVQEEDGGNYTCELK 217
>YLPM1_MOUSE (Q9R0I7) YLP motif-containing protein 1 (Nuclear protein ZAP3)| Length = 1386 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 5 HQXSTQLRPIFALPLHRAELLLARATEEPASLASPGQTRHKSSEPL 142 H S Q R LP H+ L+ A+ EP +PG + +EPL Sbjct: 252 HLLSLQQRTKVHLPGHKKGLVTAKDVPEPIKEEAPGPAASQVAEPL 297
>LIP_RHIOR (P61872) Lipase precursor (EC 3.1.1.3) (Triacylglycerol lipase)| (ROL) (RDL) Length = 392 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 154 PHAPKR-FRTLVPGLAWGS*AGWFFSGTSKQQLCSMQWQSKD 32 PH P + F L PG+ W SGTS Q+C+ + ++KD Sbjct: 330 PHVPPQSFGFLHPGVE-----SWIKSGTSNVQICTSEIETKD 366
>LIP_RHINI (P61871) Lipase precursor (EC 3.1.1.3) (Triacylglycerol lipase)| (Lipase II) (RNL) Length = 392 Score = 29.3 bits (64), Expect = 7.8 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -2 Query: 154 PHAPKR-FRTLVPGLAWGS*AGWFFSGTSKQQLCSMQWQSKD 32 PH P + F L PG+ W SGTS Q+C+ + ++KD Sbjct: 330 PHVPPQSFGFLHPGVE-----SWIKSGTSNVQICTSEIETKD 366
>HYES_PIG (Q6Q2C2) Epoxide hydrolase 2 (EC 3.3.2.3) (Soluble epoxide| hydrolase) (SEH) (Epoxide hydratase) (Cytosolic epoxide hydrolase) (CEH) Length = 555 Score = 24.3 bits (51), Expect(2) = 9.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 3 PIXPPRSCGPSLLCH 47 P PP SC PS L H Sbjct: 225 PALPPTSCDPSALSH 239 Score = 23.1 bits (48), Expect(2) = 9.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 86 EPASLASPGQTRHKSSEPLRSVRIHSTTSVCLLHGF 193 +P++L S G K L V + S +VCL HGF Sbjct: 233 DPSAL-SHGYVLIKPGVRLHFVEMGSGPAVCLCHGF 267 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,570,146 Number of Sequences: 219361 Number of extensions: 1625390 Number of successful extensions: 4283 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4282 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)