| Clone Name | baalf10 |
|---|---|
| Clone Library Name | barley_pub |
>ZFY16_MOUSE (Q80U44) Zinc finger FYVE domain-containing protein 16 (Endofin)| (Endosomal-associated FYVE domain protein) Length = 1528 Score = 43.1 bits (100), Expect = 5e-04 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +3 Query: 444 VVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 +VL + P W+PDS A +CM C FT T RHHCR Sbjct: 723 LVLGQKQPTWVPDSEAPNCMNCQVKFT-FTKRRHHCR 758
>ZFY16_HUMAN (Q7Z3T8) Zinc finger FYVE domain-containing protein 16 (Endofin)| (Endosome-associated FYVE domain protein) Length = 1539 Score = 43.1 bits (100), Expect = 5e-04 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +3 Query: 444 VVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 +VL + P W+PDS A +CM C FT T RHHCR Sbjct: 735 LVLGQKQPTWVPDSEAPNCMNCQVKFT-FTKRRHHCR 770
>ZFYV9_HUMAN (O95405) Zinc finger FYVE domain-containing protein 9 (Mothers| against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Smad anchor for receptor activation) (Receptor activation anchor) (hSARA) (Novel serine protease) Length = 1425 Score = 42.4 bits (98), Expect = 9e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 465 PEWLPDSYADSCMQCSASFTAITCGRHHCR 554 P W+PDS A +CM+C A FT T RHHCR Sbjct: 694 PVWVPDSQAPNCMKCEARFT-FTKRRHHCR 722
>FGD4_RAT (O88387) FYVE, RhoGEF and PH domain-containing protein 4 (Actin| filament-binding protein frabin) (FGD1-related F-actin-binding protein) Length = 766 Score = 41.6 bits (96), Expect = 0.002 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 414 EEALSYNIYRVVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 E + + L P W+ D+ CM+C SF A+T RHHCR Sbjct: 537 ENDIPLEVSTAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCR 583
>FGD4_MOUSE (Q91ZT5) FYVE, RhoGEF and PH domain-containing protein 4 (Actin| filement-binding protein frabin) (FGD1-related F-actin-binding protein) Length = 766 Score = 41.6 bits (96), Expect = 0.002 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 414 EEALSYNIYRVVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 E + + L P W+ D+ CM+C SF A+T RHHCR Sbjct: 537 ENDIPLEVSTAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCR 583
>FGD6_MOUSE (Q69ZL1) FYVE, RhoGEF and PH domain-containing protein 6| Length = 1399 Score = 41.6 bits (96), Expect = 0.002 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 450 LEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 L A+ P W+PD+ A CM C++ FT +T RHHCR Sbjct: 1181 LGAKAPIWIPDTRATMCMICTSEFT-LTWRRHHCR 1214
>ZFY21_MOUSE (Q8VCM3) Zinc finger FYVE domain-containing protein 21| Length = 234 Score = 41.6 bits (96), Expect = 0.002 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +3 Query: 459 EPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 E P+W+PD CMQC A F IT +HHCR Sbjct: 37 EEPQWVPDKECPRCMQCDAKFDFIT-RKHHCR 67
>ZFY21_HUMAN (Q9BQ24) Zinc finger FYVE domain-containing protein 21| Length = 234 Score = 40.4 bits (93), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +3 Query: 459 EPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 E P+W+PD CMQC A F +T +HHCR Sbjct: 37 EEPQWVPDKECRRCMQCDAKFDFLT-RKHHCR 67
>FGD6_HUMAN (Q6ZV73) FYVE, RhoGEF and PH domain-containing protein 6 (Zinc finger| FYVE domain-containing protein 24) Length = 1430 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +3 Query: 450 LEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 L ++ P W+PD+ A CM C++ FT +T RHHCR Sbjct: 1212 LGSKAPIWIPDTRATMCMICTSEFT-LTWRRHHCR 1245
>ZFY28_HUMAN (Q9HCC9) Zinc finger FYVE domain-containing protein 28| Length = 887 Score = 40.0 bits (92), Expect = 0.004 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 459 EPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 +PPEW+PD C C A FT I +HHCR Sbjct: 810 DPPEWVPDEACGFCTACKAPFTVIR-RKHHCR 840
>FGD2_MOUSE (Q8BY35) FYVE, RhoGEF and PH domain-containing protein 2| Length = 655 Score = 39.7 bits (91), Expect = 0.006 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 465 PEWLPDSYADSCMQCSASFTAITCGRHHCR 554 P+W+ D CM+C F A+T RHHCR Sbjct: 453 PQWVRDKMVTMCMRCQEPFNALTRRRHHCR 482
>FGD2_HUMAN (Q7Z6J4) FYVE, RhoGEF and PH domain-containing protein 2 (Zinc| finger FYVE domain-containing protein 4) Length = 655 Score = 39.7 bits (91), Expect = 0.006 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 465 PEWLPDSYADSCMQCSASFTAITCGRHHCR 554 P+W+ D CM+C F A+T RHHCR Sbjct: 453 PQWVRDKMVTMCMRCQEPFNALTRRRHHCR 482
>FGD4_HUMAN (Q96M96) FYVE, RhoGEF and PH domain-containing protein 4 (Actin| filament-binding protein frabin) (FGD1-related F-actin-binding protein) (Zinc finger FYVE domain-containing protein 6) Length = 766 Score = 39.3 bits (90), Expect = 0.008 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 465 PEWLPDSYADSCMQCSASFTAITCGRHHCR 554 P W+ D+ CM+C F A+T RHHCR Sbjct: 554 PRWIRDNEVTMCMKCKEPFNALTRRRHHCR 583
>FYV1_HUMAN (Q9Y2I7) FYVE finger-containing phosphoinositide kinase (EC| 2.7.1.68) (1-phosphatidylinositol-4-phosphate 5-kinase) (Phosphatidylinositol-3-phosphate 5-kinase type III) (PIP5K) (PtdIns(4)P-5-kinase) (PIKfyve) (p235) Length = 2098 Score = 35.0 bits (79), Expect = 0.14 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 W+PDS C CS FT RHHCR Sbjct: 155 WMPDSQCKECYDCSEKFTTFR-RRHHCR 181
>FYV1_MOUSE (Q9Z1T6) FYVE finger-containing phosphoinositide kinase (EC| 2.7.1.68) (1-phosphatidylinositol-4-phosphate 5-kinase) (PIP5K) (PtdIns(4)P-5-kinase) (PIKfyve) (p235) Length = 2052 Score = 35.0 bits (79), Expect = 0.14 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 W+PDS C CS FT RHHCR Sbjct: 166 WMPDSQCKECYDCSEKFTTFR-RRHHCR 192
>FYV1_DROME (O96838) Putative FYVE finger-containing phosphoinositide kinase| (EC 2.7.1.68) (1-phosphatidylinositol-4-phosphate 5-kinase) (PIP5K) (PtdIns(4)P-5-kinase) Length = 1809 Score = 33.5 bits (75), Expect = 0.42 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 W+PDS A C CS F+ +HHCR Sbjct: 183 WMPDSKAKECYDCSQKFSTFR-RKHHCR 209
>FGD1_MOUSE (P52734) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein homolog) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 960 Score = 32.7 bits (73), Expect = 0.71 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 411 DEEALSYNIYRVVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 D+E N V L P + + CM+C F +IT RHHC+ Sbjct: 706 DDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCK 753
>MTMR3_HUMAN (Q13615) Myotubularin-related protein 3 (EC 3.1.3.48) (FYVE| domain-containing dual specificity protein phosphatase 1) (FYVE-DSP1) (Zinc finger FYVE domain containing protein 10) Length = 1198 Score = 32.3 bits (72), Expect = 0.93 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 453 EAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 + E WLPD A C C ++F + +HHCR Sbjct: 1110 DTEMTRWLPDHLAAHCYACDSAFW-LASRKHHCR 1142
>YOTB_CAEEL (P34657) Hypothetical protein ZK632.12| Length = 266 Score = 31.6 bits (70), Expect = 1.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 W+PD A CM C + + RHHCR Sbjct: 149 WVPDGEAVKCMVCGKTQFNLVQRRHHCR 176
>FGD5_HUMAN (Q6ZNL6) FYVE, RhoGEF and PH domain-containing protein 5 (Zinc finger| FYVE domain-containing protein 23) Length = 1462 Score = 31.6 bits (70), Expect = 1.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 444 VVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHC 551 V L PP +P ++ CM C F ++T RHHC Sbjct: 1230 VSLGERPPTLVPVTHVMMCMNCGCDF-SLTLRRHHC 1264
>PIB2_YEAST (P53191) Protein PIB2| Length = 635 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 W+PDS +SC C FT + +HHCR Sbjct: 449 WIPDSKRNSCRYCHKPFT-LWERKHHCR 475
>FGD1_HUMAN (P98174) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 961 Score = 31.2 bits (69), Expect = 2.1 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 411 DEEALSYNIYRVVLEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 ++E N V L P + + CM+C F +IT RHHC+ Sbjct: 707 EDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCK 754
>RUFY1_HUMAN (Q96T51) RUN and FYVE domain-containing protein 1 (FYVE-finger| protein EIP1) (Zinc finger FYVE domain-containing protein 12) Length = 600 Score = 30.8 bits (68), Expect = 2.7 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 471 WLPDSYADSCMQCSASFTAITCGRHHCR 554 WL D A C QC F +I+ +HHCR Sbjct: 531 WLKDDEATHCRQCEKEF-SISRRKHHCR 557
>ZFYV1_MOUSE (Q810J8) Zinc finger FYVE domain-containing protein 1| Length = 777 Score = 30.4 bits (67), Expect = 3.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 462 PPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 P W P+S SC QC+ SF +HHCR Sbjct: 592 PAYWRPNSQILSCNQCATSFKD-NDTKHHCR 621
>PEP7_SCHPO (O13786) Vacuolar segregation protein pep7| Length = 536 Score = 30.4 bits (67), Expect = 3.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 450 LEAEPPEWLPDSYADSCMQCSASFTAITCGRHHCR 554 LE W DS C +C+ SFT +T R HCR Sbjct: 265 LEQSIVHWQDDSVVQICPECNNSFT-LTRRRRHCR 298
>JAG1A_BRARE (Q90Y57) Jagged-1a precursor (Jagged1a) (Jagged1)| Length = 1242 Score = 30.4 bits (67), Expect = 3.5 Identities = 21/75 (28%), Positives = 32/75 (42%) Frame = -1 Query: 234 LAFLPSAVPGPNSHQGIHIHQGNHFHHQNQTAFARITLTQGS*RHFQLFPMLAEATTLDQ 55 L + S+V GP+ H H G HF Q F T + + P L+ T +D+ Sbjct: 592 LRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTG-TYCHENINDCESSPCLSGGTCIDK 650 Query: 54 LS**HCLSCP*PWSG 10 ++ C+ C W G Sbjct: 651 INAYQCI-CADGWEG 664
>FGD3_HUMAN (Q5JSP0) FYVE, RhoGEF and PH domain-containing protein 3 (Zinc| finger FYVE domain-containing protein 5) Length = 725 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 480 DSYADSCMQCSASFTAITCGRHHCR 554 D SC C +F +IT RHHC+ Sbjct: 532 DKEKQSCKSCGETFNSITKRRHHCK 556
>FGD3_PONPY (Q5R5T1) FYVE, RhoGEF and PH domain-containing protein 3| Length = 737 Score = 30.4 bits (67), Expect = 3.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 480 DSYADSCMQCSASFTAITCGRHHCR 554 D SC C +F +IT RHHC+ Sbjct: 532 DKEKQSCKSCGETFNSITKRRHHCK 556
>RPOA_LDVC (Q06502) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3637 Score = 29.6 bits (65), Expect = 6.0 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 52 QLIQSRCLSKHGKQLEMPLTPLSQSYPGKSRLILMVEMISLMDMNALMTIGTRNCR 219 Q+ +RCL+ PL PLSQ +P L L S + A +T T+ CR Sbjct: 22 QVYCTRCLAAR------PLLPLSQQHPRLGALGLFYRPASPLSWEAPVTYPTKECR 71
>DNAK_BUCAI (O32464) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 637 Score = 29.3 bits (64), Expect = 7.9 Identities = 20/63 (31%), Positives = 29/63 (46%) Frame = +3 Query: 237 NIRNLLGGIVAIIGRTCKNDEIQQSKDTKXXXXXXXXXXDGDTFLHTSVYAPSAPPLLDE 416 N +N L I +IGR K+DE+Q +D K +GD ++ APP + Sbjct: 61 NPKNTLFAIKRLIGRKFKDDEVQ--RDIKIMPYNIVNSDNGDAWIDVK-KQKMAPPQISA 117 Query: 417 EAL 425 E L Sbjct: 118 EVL 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,015,711 Number of Sequences: 219361 Number of extensions: 1372018 Number of successful extensions: 4529 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 4338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4499 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)