| Clone Name | baalc23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAC1G_HUMAN (O43497) Voltage-dependent T-type calcium channel al... | 32 | 1.2 | 2 | HRP1_PLAFA (P05227) Histidine-rich protein precursor (Clone PFHR... | 30 | 6.0 |
|---|
>CAC1G_HUMAN (O43497) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) (Cav3.1c) (NBR13) Length = 2377 Score = 32.0 bits (71), Expect = 1.2 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 366 SEPAPHGAADARPQDTLGRGCRRRHRADSHRQAVQPHPHDCHHPYL 503 S PAP G + +P + C R HR S V H H HH +L Sbjct: 466 SSPAPLGGQETQPSSS----CSRSHRRLSVHHLVHHHHHHHHHYHL 507
>HRP1_PLAFA (P05227) Histidine-rich protein precursor (Clone PFHRP-II)| Length = 332 Score = 29.6 bits (65), Expect = 6.0 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +3 Query: 381 HGAADARPQDTLGRGCRRRHRADSHRQAVQPHPHDCHHPYLRVAARFRGARH 536 H A DA H AD+H A H D HH + A A H Sbjct: 250 HHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAHH 301 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,863,935 Number of Sequences: 219361 Number of extensions: 886648 Number of successful extensions: 2891 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2879 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)