| Clone Name | baalb22 |
|---|---|
| Clone Library Name | barley_pub |
>PALA_YEAST (Q12033) pH-response regulator protein palA/RIM20 (Regulator of| IME2 protein 20) Length = 661 Score = 30.0 bits (66), Expect = 5.8 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 155 VDGIACFMAAYLLSLKETKELTPNQLQEALSKTFSTKKR-KGKLQKAWAGTQVIYNV 322 +DG++ Y++ L+ K+ NQ++ +T S K R + W +IYN+ Sbjct: 57 IDGLSALKEYYVILLQLEKKFPNNQIEFTWFQTLSQKSRGTSQYSLQWEKLTIIYNI 113
>GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 precursor| Length = 1200 Score = 30.0 bits (66), Expect = 5.8 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +1 Query: 352 LPESGDSKSSNSGLLDILPRGVQVPVNSHEILYTLYDNLDFPVPPLREALLSNSVTMRSS 531 L + GD + S +DI+P NSH+ L + + + PL + SVT+ +S Sbjct: 1128 LNQMGDQEKQTSSSVDIIPGSCNSSNNSHQPLTSRAEVCPWEFEPLEQPNAERSVTLPAS 1187
>SRPX_HUMAN (P78539) Sushi repeat-containing protein SRPX precursor| Length = 464 Score = 29.3 bits (64), Expect = 9.9 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 346 WYLPESGDSKSS--NSGLLDILPRGVQVPVNSHEILYTLYDNLD 471 W PE D+ +L LP G P H+I YT+YD + Sbjct: 203 WETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAE 246
>BSU1_ARATH (Q9LR78) Serine/threonine-protein phosphatase BSU1 (EC 3.1.3.16)| (Bri1 suppressor protein 1) Length = 793 Score = 29.3 bits (64), Expect = 9.9 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +2 Query: 5 TFXKSVYQHGAVDETISWDIVSAADIWDDKSMNVSDDSEDGYVLVKQ--EDIVDGIACFM 178 +F +Y HG + E + D + A+ S +D+ D Y+L+ D ++ Sbjct: 325 SFGSHLYVHGGIREDVLLDDLLVAETSQSSSPEPEEDNPDNYMLLDDYLMDEPKPLSSEP 384 Query: 179 AAYLLSLKETKELTPNQLQEA 241 A ++ T E+ ++L EA Sbjct: 385 EASSFIMRSTSEIAMDRLAEA 405
>CCPA_STAES (Q8CNV8) Probable catabolite control protein A| Length = 329 Score = 29.3 bits (64), Expect = 9.9 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +2 Query: 128 YVLVKQEDIVDGIACFMAAYLLSLKETKELTPNQLQEALSKTF 256 Y + Q+D+++G+ ++ + L L +T LT N+ ++ KTF Sbjct: 187 YSIKAQDDVLEGLKNVLSQHQLKLDDTLHLTGNESYKSGIKTF 229
>CCPA_STAEQ (Q5HNH3) Probable catabolite control protein A| Length = 329 Score = 29.3 bits (64), Expect = 9.9 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +2 Query: 128 YVLVKQEDIVDGIACFMAAYLLSLKETKELTPNQLQEALSKTF 256 Y + Q+D+++G+ ++ + L L +T LT N+ ++ KTF Sbjct: 187 YSIKAQDDVLEGLKNVLSQHQLKLDDTLHLTGNESYKSGIKTF 229
>AAA_STAAB (Q2YVT4) N-acetylmuramoyl-L-alanine amidase aaa precursor (EC| 3.5.1.28) Length = 335 Score = 29.3 bits (64), Expect = 9.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 352 LPESGDSKSSNSGLLDILPRGVQVPVNSHEILYT 453 L +G++ SSNS RG PV SH+ LYT Sbjct: 199 LKVTGNATSSNSASATTTNRGYNTPVFSHQNLYT 232
>ZDH12_MOUSE (Q8VC90) Probable palmitoyltransferase ZDHHC12 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 12) (DHHC-12) Length = 267 Score = 29.3 bits (64), Expect = 9.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 431 IVMRSCTHCMIIWTSPYLHCGKRCCQTLSRCDHH 532 + +R C HC+++ HC + C + + R DHH Sbjct: 94 VPLRRCRHCLVLQPLRARHC-RDCRRCVRRYDHH 126
>OR2A_DROME (O46077) Odorant receptor 2a| Length = 397 Score = 29.3 bits (64), Expect = 9.9 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = -3 Query: 501 QRFPQWRYGEVQIIIQCVQDLMTIHRNLDTTRQDVQKAAVAAFRIAGFW*IPIAVALH 328 Q + WR Q +I+C++DL +HR + ++ + +A F + + VA+H Sbjct: 234 QTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAA--VQCTVAMH 289
>NIFD_SYNP8 (Q55029) Nitrogenase molybdenum-iron protein alpha chain (EC| 1.18.6.1) (Nitrogenase component I) (Dinitrogenase) Length = 476 Score = 29.3 bits (64), Expect = 9.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 499 ALPAMEVRGSPDYHTMCTGSHDYSQELGHHAA 404 A A ++ G P + C G SQ LGHH A Sbjct: 163 AKKAQKITGKPVFPFRCEGFRGVSQSLGHHIA 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,256,214 Number of Sequences: 219361 Number of extensions: 1673788 Number of successful extensions: 4869 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4861 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)