| Clone Name | baal9p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBP23_HORVU (P52711) Serine carboxypeptidase II-3 precursor (EC ... | 57 | 1e-08 | 2 | CBP21_HORVU (P55747) Serine carboxypeptidase II-1 precursor (EC ... | 33 | 0.22 | 3 | VPE_SOYBN (P49045) Vacuolar processing enzyme precursor (EC 3.4.... | 28 | 9.4 |
|---|
>CBP23_HORVU (P52711) Serine carboxypeptidase II-3 precursor (EC 3.4.16.6)| (CP-MII.3) [Contains: Serine carboxypeptidase II-3 chain A; Serine carboxypeptidase II-3 chain B] Length = 516 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 3 NAVINDWTDSKGMYDFFWTHALIXXE 80 NAVINDWTDSKGMYDFFWTHALI E Sbjct: 266 NAVINDWTDSKGMYDFFWTHALISDE 291
>CBP21_HORVU (P55747) Serine carboxypeptidase II-1 precursor (EC 3.4.16.6)| (CP-MII.1) [Contains: Serine carboxypeptidase II-1 chain A; Serine carboxypeptidase II-1 chain B] (Fragment) Length = 324 Score = 33.1 bits (74), Expect = 0.22 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 3 NAVINDWTDSKGMYDFFWTHALIXXE 80 NAVI+D+ D G ++++WTH LI + Sbjct: 75 NAVIDDYHDFVGTFEYWWTHGLISDD 100
>VPE_SOYBN (P49045) Vacuolar processing enzyme precursor (EC 3.4.22.-) (VPE)| Length = 495 Score = 27.7 bits (60), Expect = 9.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 3 NAVINDWTDSKGMYDFFWTHALIXXEHGRRHQQ 101 +++++DWT K M F TH ++G +H + Sbjct: 423 SSLVDDWTCLKSMVRVFETHCGTLTQYGMKHMR 455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.294 0.125 0.334 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,838,417 Number of Sequences: 219361 Number of extensions: 49990 Number of successful extensions: 59 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 80,573,946 effective HSP length: 13 effective length of database: 77,722,253 effective search space used: 1865334072 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 44 (21.7 bits)