| Clone Name | baal9o01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YIF0_YEAST (P40186) Hypothetical 32.0 kDa protein in RPL34B-SYG1... | 41 | 0.003 | 2 | YEO9_YEAST (P40038) Hypothetical 47.0 kDa protein in PET117-CEM1... | 34 | 0.36 | 3 | PO2F1_MOUSE (P25425) POU domain, class 2, transcription factor 1... | 30 | 9.0 |
|---|
>YIF0_YEAST (P40186) Hypothetical 32.0 kDa protein in RPL34B-SYG1 intergenic| region Length = 285 Score = 41.2 bits (95), Expect = 0.003 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 6/136 (4%) Frame = +1 Query: 193 VRAFRGGATPTIPIVEFLERLQR----CNYLFDSXXXXXXXXXXXXFMRSP--AALEAGI 354 + AF G P I +V++LER+Q+ N +F S S + Sbjct: 147 ILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLF 206 Query: 355 VVEPATAHRLVSVAVLIGAKFVSPRYFERRVESFQICSGQSIRSSEMCPLELLFLRALNY 534 V++ HRL+ V I KF+S ++ + G S++ E+ LEL FL ++ Sbjct: 207 VMDSGNIHRLLITGVTICTKFLSDFFYSN--SRYAKVGGISLQ--ELNHLELQFLILCDF 262 Query: 535 RLFIADEEFQRFFRIL 582 +L ++ EE Q++ +L Sbjct: 263 KLLVSVEEMQKYANLL 278
>YEO9_YEAST (P40038) Hypothetical 47.0 kDa protein in PET117-CEM1 intergenic| region Length = 420 Score = 34.3 bits (77), Expect = 0.36 Identities = 22/78 (28%), Positives = 39/78 (50%) Frame = +1 Query: 355 VVEPATAHRLVSVAVLIGAKFVSPRYFERRVESFQICSGQSIRSSEMCPLELLFLRALNY 534 V++ HRL+ + + KF+S ++ + G S++ E+ LEL FL ++ Sbjct: 331 VMDSHNIHRLIIAGITVSTKFLSDFFYSN--SRYSRVGGISLQ--ELNHLELQFLVLCDF 386 Query: 535 RLFIADEEFQRFFRILER 588 L I+ E QR+ +L R Sbjct: 387 ELLISVNELQRYADLLYR 404
>PO2F1_MOUSE (P25425) POU domain, class 2, transcription factor 1| (Octamer-binding transcription factor 1) (Oct-1) (OTF-1) (NF-A1) Length = 770 Score = 29.6 bits (65), Expect = 9.0 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = -1 Query: 248 SRNSTMGMVGVAPPRNARTRSFSAGWEAAEEAKRRDSASTSDAKRRSVLGFPLPS 84 S N+T ++ APP ++ S S + A +++S S+ PLPS Sbjct: 529 SNNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETNTTQTTSTPLPS 583 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,137,538 Number of Sequences: 219361 Number of extensions: 929623 Number of successful extensions: 3667 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3664 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)