| Clone Name | baal9m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BPT1_YEAST (P14772) Bile pigment transporter 1 | 29 | 3.2 | 2 | YAE9_YEAST (P39721) Protein YAL049C | 28 | 4.1 | 3 | 2NPD_NEUCR (Q01284) 2-nitropropane dioxygenase precursor (EC 1.1... | 27 | 9.2 | 4 | PRM2_PONPY (P35301) Protamine-2 (Protamine-P2) (Sperm histone P2) | 27 | 9.2 | 5 | PRM2_MOUSE (P07978) Protamine-2 (Protamine-P2) (Sperm histone P2... | 27 | 9.2 | 6 | ORC1_MOUSE (Q9Z1N2) Origin recognition complex subunit 1 | 27 | 9.2 |
|---|
>BPT1_YEAST (P14772) Bile pigment transporter 1| Length = 1559 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 88 RRSLQQPHLRHYISRSIHEKPQGRSCQSE 2 +R+++Q HL+ ++ + +H KP+G E Sbjct: 1409 KRAVEQAHLKPHLEKMLHSKPRGDDSNEE 1437
>YAE9_YEAST (P39721) Protein YAL049C| Length = 246 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 16 IFPGVSHGWTVRYNGEDAAAVKSAEEALTDMXDWFN 123 +F GV+HG+ R + A + E+ L D WFN Sbjct: 206 LFSGVAHGFAARGDISIPAVKYAKEKVLLDQIYWFN 241
>2NPD_NEUCR (Q01284) 2-nitropropane dioxygenase precursor (EC 1.13.11.32)| (Nitroalkane oxidase) (2-NPD) Length = 378 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 46 VRYNGEDAAAVKSAEEALTDMXDWFNKNLK*T*ISGPPFVITN 174 + + G + +SA+ ALT + WF IS P ++I N Sbjct: 1 MHFPGHSSKKEESAQAALTKLNSWFPTTKNPVIISAPMYLIAN 43
>PRM2_PONPY (P35301) Protamine-2 (Protamine-P2) (Sperm histone P2)| Length = 102 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 320 SRPRNEQSHTNQH-ACDRQRRMSYRHR 243 SR R + H QH +C R+RR S RHR Sbjct: 59 SRRRLHRIHRQQHRSCKRRRRHSCRHR 85
>PRM2_MOUSE (P07978) Protamine-2 (Protamine-P2) (Sperm histone P2) [Contains:| PP2-A; PP2-C; PP2-D; PP2-B (Protamine MP2)] Length = 107 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 320 SRPRNEQSHTNQHACDRQRRMSYRHR 243 SR R + H + +C R+RR S RHR Sbjct: 56 SRKRLHRIHKRRRSCRRRRRHSCRHR 81
>ORC1_MOUSE (Q9Z1N2) Origin recognition complex subunit 1| Length = 840 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +2 Query: 116 GLTRTSSEPEXXXXXXXXXISLCHSSRVITRASGVYVM--VFALADAYRTCVFVCRRRAG 289 GLTR S +P +S + R + V V AL+ R C+ +CRR Sbjct: 651 GLTRMSFQPYSHSQLKQILVSRLRNLRAFEDDAIQLVARKVAALSGDARRCLDICRRATE 710 Query: 290 WCVIAH 307 C ++H Sbjct: 711 ICELSH 716 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,357,116 Number of Sequences: 219361 Number of extensions: 914840 Number of successful extensions: 2190 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2190 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)