| Clone Name | baal9k12 |
|---|---|
| Clone Library Name | barley_pub |
>ATPD_SPIOL (P11402) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 257 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/48 (35%), Positives = 34/48 (70%) Frame = +3 Query: 18 NLAIE*VVEPSLIAGFVVCYGLDDSHTIDLSVRGRLAALKSRVDNSDL 161 N+ I+ V++PSL+AGF + YG + S +D+SV+ +L + ++++ D+ Sbjct: 206 NVRIKTVIDPSLVAGFTIRYGNEGSKLVDMSVKKQLEEIAAQLEMDDV 253
>ATPD_PEA (Q02758) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 251 Score = 38.9 bits (89), Expect = 0.004 Identities = 17/42 (40%), Positives = 29/42 (69%) Frame = +3 Query: 36 VVEPSLIAGFVVCYGLDDSHTIDLSVRGRLAALKSRVDNSDL 161 +++PSL+AGF V YG S ID+SV+ +L + +++D D+ Sbjct: 206 LLDPSLVAGFTVRYGNTGSKFIDMSVKRKLEEIAAQIDLGDI 247
>ATPD_SORBI (Q07300) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 247 Score = 38.9 bits (89), Expect = 0.004 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = +3 Query: 18 NLAIE*VVEPSLIAGFVVCYGLDDSHTIDLSVRGRLAALKSRVDNSDL 161 N+ ++ ++P LIAGF V YG D S ID+SVR ++ + S + D+ Sbjct: 196 NVRLKTQLDPELIAGFTVQYGRDGSSLIDMSVRKQIEEITSEFELPDV 243
>ATPD_TOBAC (P32980) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 248 Score = 37.7 bits (86), Expect = 0.008 Identities = 17/48 (35%), Positives = 32/48 (66%) Frame = +3 Query: 18 NLAIE*VVEPSLIAGFVVCYGLDDSHTIDLSVRGRLAALKSRVDNSDL 161 N+ I+ V++ SL+AGF + YG S ID+SV+ +L + ++++ D+ Sbjct: 197 NVRIKTVIDESLVAGFTIRYGNSGSKLIDMSVKKQLEDIAAQLEIGDI 244
>ATPD_CHLRE (Q42687) ATP synthase delta chain, chloroplast precursor (EC| 3.6.3.14) Length = 219 Score = 36.6 bits (83), Expect = 0.018 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +3 Query: 18 NLAIE*VVEPSLIAGFVVCYGLDDSHTIDLSVRGRL 125 N+ ++ V++ SLIAGFVV YG S IDLSVRG++ Sbjct: 171 NIKLKPVIDSSLIAGFVVEYG---SSQIDLSVRGQI 203
>ATPD_GALSU (P35010) ATP synthase delta chain, chloroplast (EC 3.6.3.14)| Length = 177 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +3 Query: 39 VEPSLIAGFVVCYGLDDSHTIDLSVRGRL 125 ++PSLI G ++ +G S+ IDLS++G+L Sbjct: 146 IDPSLIGGLIIKFG---SNLIDLSLKGKL 171
>GLUQ_NOCFA (Q5Z380) Glutamyl-Q tRNA(Asp) synthetase (EC 6.1.1.-) (Glu-Q-RSs)| Length = 311 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +3 Query: 72 CYGLDDSHTIDLSVRGRLAALKSRVDNSDLD--DRLHPRTPAPL 197 C L D+ + +GR AAL+ R + +D + D+LH R P+ Sbjct: 129 CRDLSDADRAERRAQGRPAALRLRAERTDFEIVDQLHGRYRGPV 172
>ATPD_OCHNE (Q40610) ATP synthase delta chain, chloroplast (EC 3.6.3.14)| Length = 179 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 39 VEPSLIAGFVVCYGLDDSHTIDLSVRGRLAALKS 140 VEP LI GF V G S ID S+RG+L + + Sbjct: 145 VEPKLIGGFTVEIG---SKLIDTSIRGQLKKISN 175
>FAT2_RAT (O88277) Protocadherin Fat 2 precursor (Multiple epidermal growth| factor-like domains 1) Length = 4351 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 78 GLDDSHTIDLSVRGRLAALKSRVDNSDLDDRLHPRTPAP 194 GL L + + A L R N +L+D + PR P+P Sbjct: 4223 GLYGGFPFPLELENKRAPLPPRYSNQNLEDLMPPRPPSP 4261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,720,236 Number of Sequences: 219361 Number of extensions: 184866 Number of successful extensions: 555 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)