ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal9f22 |
|---|---|
| Clone Library Name | barley_pub |
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC 4.6.1.1)| (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 32.7 bits (73), Expect = 0.24 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = -1 Query: 299 PPHHLYPPQEVNCKQNHPPLFLVRRYFPSQEAMV*LHQTSASVRASLIAHXQQPXMHKP 123 PPHHL+ +N Q HPP F Y +E+ LH +S + A ++ P P Sbjct: 1431 PPHHLHSNLNLNQSQ-HPPSFTSLGYGQCRESEPLLHASSVAPVAKIMPMQHAPKYEPP 1488
>POU47_BRARE (P79746) POU domain protein ZP-47| Length = 378 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 118 DRHKQHSSPDGHLPDDQHNRQCHQGDQEESN 26 D H H S GH P QH Q HQ + S+ Sbjct: 170 DHHSPHLSDHGH-PPSQHQHQSHQSHHDHSD 199
>MIZF_MOUSE (Q8K1K9) MBD2-interacting zinc finger protein (Methyl-CpG-binding| protein 2-interacting zinc finger protein) Length = 503 Score = 29.6 bits (65), Expect = 2.0 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 17/84 (20%) Frame = -2 Query: 235 LCEDTSPHRKQWCDYIKLQHPCVLP**LXCSNHXCINXIDRHKQ---HSSPDGHLPD--- 74 LC+ T P ++++ +H P C ++ C N ID K HS + D Sbjct: 255 LCDMTCPLPSSLRNHMRFRHSEDRPYKCDCCDYSCKNLIDLRKHLDTHSKESAYRCDFEN 314 Query: 73 -----------DQHNRQCHQGDQE 35 H+R+ H+GD E Sbjct: 315 CNFSARSLSSVKSHHRKVHEGDSE 338
>PALY_USTMA (Q96V77) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 724 Score = 28.5 bits (62), Expect = 4.5 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +2 Query: 35 FLITLVALSIMLIVGKVTVWGAMLFVSIXXXXXXXXXXXELLRKHARMLKFDVVTPLLPV 214 F + L LI+ + V GA++ E+L K ++ + VTP++PV Sbjct: 140 FALPLTDTESSLIMPEAWVRGAIVVRLSSLMRGHSGVRWEVLDKMQKLFLQNNVTPVVPV 199 Query: 215 RGSIFAQG 238 R SI A G Sbjct: 200 RSSISASG 207
>CASR_RAT (P48442) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1079 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 292 ITCILLKK*TVNRIILLYSLCEDTSPHRKQW 200 I+CIL+K NR++L++ TS HRK W Sbjct: 692 ISCILVK---TNRVLLVFEAKIPTSFHRKWW 719
>CASR_MOUSE (Q9QY96) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1079 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 292 ITCILLKK*TVNRIILLYSLCEDTSPHRKQW 200 I+CIL+K NR++L++ TS HRK W Sbjct: 692 ISCILVK---TNRVLLVFEAKIPTSFHRKWW 719
>CASR_HUMAN (P41180) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1078 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 292 ITCILLKK*TVNRIILLYSLCEDTSPHRKQW 200 I+CIL+K NR++L++ TS HRK W Sbjct: 692 ISCILVK---TNRVLLVFEAKIPTSFHRKWW 719
>HIW_DROME (Q9NB71) Ubiquitin ligase protein highwire (EC 6.3.2.-) (Protein| pam/highwire/rpm-1) Length = 5233 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 106 QHSSPDGHLPDDQHNRQCHQGDQEESNIPHKAPPI 2 QH+ P H P QH++Q Q + H+APP+ Sbjct: 3905 QHNHPPPHHPQQQHHQQQQMNLQLQQ---HQAPPV 3936
>CASR_BOVIN (P35384) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1085 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 292 ITCILLKK*TVNRIILLYSLCEDTSPHRKQW 200 I+CIL+K NR++L++ TS HRK W Sbjct: 693 ISCILVK---TNRVLLVFEAKIPTSFHRKWW 720
>MIZF_HUMAN (Q9BQA5) MBD2-interacting zinc finger protein (Methyl-CpG-binding| protein 2-interacting zinc finger protein) Length = 517 Score = 28.1 bits (61), Expect = 5.9 Identities = 21/84 (25%), Positives = 32/84 (38%), Gaps = 17/84 (20%) Frame = -2 Query: 235 LCEDTSPHRKQWCDYIKLQHPCVLP**LXCSNHXCINXIDRHKQ---HSSPDGHLPD--- 74 LC+ T P ++++ +H P C ++ C N ID K HS + D Sbjct: 259 LCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLQKHLDTHSEEPAYRCDFEN 318 Query: 73 -----------DQHNRQCHQGDQE 35 H R+ H+GD E Sbjct: 319 CTFSARSLCSIKSHYRKVHEGDSE 342
>ASHH2_ARATH (Q2LAE1) Histone-lysine N-methyltransferase, H3 lysine-4 and H3| lysine-36 specific ASHH2 (EC 2.1.1.43) (H3-K4-HMTase) (H3-K36-HMTase) (Histone H3-K36 methyltransferase 8) (ASH1-homolog protein 2) (Protein EARLY FLOWERING IN SHORT DAYS) (Prote Length = 1759 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 112 HKQHSSPDGHLPDDQHNRQCHQGDQEESN 26 H + G+L + +HNR H G+ E SN Sbjct: 525 HHEPQRSQGNLNNGEHNRSSHNGNVEGSN 553
>R1AB_CVMA5 (P16342) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase Length = 7176 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -2 Query: 265 TVNRIILLYSLCEDTSPHRKQWCDYIK 185 T+ I+L Y+ CE++ +K W D+++ Sbjct: 4595 TLKEILLTYAECEESYFQKKDWYDFVE 4621 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,839,413 Number of Sequences: 219361 Number of extensions: 714475 Number of successful extensions: 2394 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2391 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
