| Clone Name | baal8p20 |
|---|---|
| Clone Library Name | barley_pub |
>RT31_MOUSE (Q61733) 28S ribosomal protein S31, mitochondrial precursor (S31mt)| (MRP-S31) (Imogen 38) Length = 384 Score = 31.6 bits (70), Expect = 2.1 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 7/95 (7%) Frame = +3 Query: 315 ILRRLLSFLKPDTFQGAVKAMNERILS--VLDASGSGRV----DLGMFFAIIAPICSGPV 476 +L R+ +FL+P F G + R +S VL A+ SG V ++ F ICS V Sbjct: 1 MLHRIPAFLRPRPFSGLPLSCGNRDVSVAVLPAAQSGAVRTENNIQRHFCTSRSICSKKV 60 Query: 477 DRRKRVVFDALLWRPASEGGRG-QIRRSDALSYIK 578 D + V + + + A GRG + + D L IK Sbjct: 61 D--QSVPANEISQKAAESQGRGKETLKKDLLDIIK 93
>Y1316_MYCLE (P46509) Putative AAA-family ATPase ML1316| Length = 609 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 84 EAFVIVEASKFKRVGRKTTLRQDLANALDIRAFERTTKLGHCDVE 218 EA +VEA F+ VG +TLR+ LA+ R +GH D E Sbjct: 145 EALTVVEAGTFEAVGEVSTLREVLADG------HRALVVGHADEE 183
>MAP1B_RAT (P15205) Microtubule-associated protein 1B (MAP 1B) (Neuraxin)| [Contains: MAP1 light chain LC1] Length = 2459 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 9/56 (16%) Frame = -1 Query: 560 ITPPDLAPATFACRTPKE---------CIENDTLAPIHWTRTDWSNDGKEHPEINA 420 I+PPD +P T RTP + IE +P H D+S +HP + A Sbjct: 1610 ISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEHSLAMDFSRQSPDHPTVGA 1665
>MAP1B_MOUSE (P14873) Microtubule-associated protein 1B (MAP 1B) (MAP1.2)| (MAP1(X)) [Contains: MAP1 light chain LC1] Length = 2464 Score = 31.2 bits (69), Expect = 2.8 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 9/57 (15%) Frame = -1 Query: 560 ITPPDLAPATFACRTPKE---------CIENDTLAPIHWTRTDWSNDGKEHPEINAA 417 I+PPD +P T RTP + IE +P H D+S +HP + A+ Sbjct: 1615 ISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEHSFAMDFSRQSPDHPTLGAS 1671
>GUC1A_CHICK (P79880) Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate| cyclase activator 1A) Length = 198 Score = 31.2 bits (69), Expect = 2.8 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +3 Query: 381 ERILSVLDASGSGRVDLGMFFAIIAPICSGPVDRRKRVVFDALLWRPASEGGRGQIRRSD 560 E++ D + G +D + A ++ + G VD++ R F G G I R + Sbjct: 55 EQMFETFDFNKDGYIDFMEYVAALSLVLKGKVDQKLRWYFKLY-----DVDGNGCIDRGE 109 Query: 561 ALSYIKLLRAV 593 L+ IK +RA+ Sbjct: 110 LLNIIKAIRAI 120
>Y2139_MYCBO (P63346) Putative AAA-family ATPase Mb2139c| Length = 609 Score = 31.2 bits (69), Expect = 2.8 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 84 EAFVIVEASKFKRVGRKTTLRQDLANALDIRAFERTTKLGHCDVE 218 EA +VEA F+ VG +TLR+ LA+ R +GH D E Sbjct: 145 EALTVVEAGTFEAVGEISTLREILADG------HRALVVGHADEE 183
>Y2115_MYCTU (P63345) Putative AAA-family ATPase Rv2115c/MT2175| Length = 609 Score = 31.2 bits (69), Expect = 2.8 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 84 EAFVIVEASKFKRVGRKTTLRQDLANALDIRAFERTTKLGHCDVE 218 EA +VEA F+ VG +TLR+ LA+ R +GH D E Sbjct: 145 EALTVVEAGTFEAVGEISTLREILADG------HRALVVGHADEE 183
>FRVR_ECOLI (P32152) Putative frv operon regulatory protein [Includes: Putative| phosphotransferase EIIA component (EC 2.7.1.-) (Putative PTS system EIIA component)] Length = 582 Score = 30.0 bits (66), Expect = 6.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 392 ENSFIHCLHCTLEGVWLEER*EPAKNNLKSCFP 294 EN H L C VW+ E + + NNLK+ +P Sbjct: 274 ENITGHLLRCLAAPVWIAEHRQSSMNNLKAAWP 306
>RECQ4_MOUSE (Q75NR7) ATP-dependent DNA helicase Q4 (EC 3.6.1.-) (RecQ| protein-like 4) Length = 1216 Score = 29.6 bits (65), Expect = 8.1 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 443 CH-HCSNLFWSSG*AQACRFRCTPLASCKRRWQGPDQEE 556 CH HC S QA RC PLA+C+ +W D + Sbjct: 954 CHLHCLG---GSAQLQALAHRCPPLAACQAKWPPKDTSQ 989
>SASA_SYNPX (Q7U871) Adaptive-response sensory-kinase sasA (EC 2.7.13.3)| Length = 383 Score = 29.6 bits (65), Expect = 8.1 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 Query: 141 LRQDLANALDIRAFERTTKLGHCDVELLRKEMNETDVPVSYSGTGIPEKSIRKAALE 311 +RQ L N L+ A + T GH + +L + +V V SG GIP + ++ L+ Sbjct: 258 MRQVLLNLLE-NALKYTGNGGHITLTMLHRTSQRVEVSVCDSGPGIPTEEQQRIFLD 313 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,676,555 Number of Sequences: 219361 Number of extensions: 1940060 Number of successful extensions: 5791 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5788 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)