| Clone Name | baal8l24 |
|---|---|
| Clone Library Name | barley_pub |
>YLN9_CAEEL (Q09512) Hypothetical protein D2013.9 in chromosome II| Length = 662 Score = 32.0 bits (71), Expect = 0.70 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 227 GIPVNHSTPPDLFLPCLMLLPQNCTFRV 310 G V HST P++ + LM LPQNC + + Sbjct: 211 GTRVRHSTEPNVRIVPLMFLPQNCAYSI 238
>CLC4F_MOUSE (P70194) C-type lectin domain family 4 member F (C-type lectin| superfamily member 13) (C-type lectin 13) (Kupffer cell receptor) Length = 548 Score = 30.8 bits (68), Expect = 1.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 106 LIDKALKGALILWRNFLGHPWGNAQSGGFWSTN 8 L D+ +G +WR G P+ NAQS GFW N Sbjct: 472 LTDQGTEG---IWRWVDGTPFNNAQSKGFWGKN 501
>HIF1A_ONCMY (Q98SW2) Hypoxia-inducible factor 1 alpha (HIF-1 alpha) (HIF1| alpha) Length = 766 Score = 30.4 bits (67), Expect = 2.0 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 181 SVCSSDHVRNKFVDYWDPGEPFNTP*SFFALPNVAAS 291 S+CSS + + Y PG PFN P S A P +AAS Sbjct: 590 SLCSSVRLTQEVHSY--PGSPFNAPGSLTASPALAAS 624
>POL1_BAYMG (Q04574) Genome polyprotein 1 [Contains: Protein P3; 6 kDa protein 1| (6K1); Cytoplasmic inclusion protein (CI); 6 kDa protein 2 (6K2); Viral genome-linked protein (VPg); Nuclear inclusion protein A (EC 3.4.22.44) (NI-a) (NIa) (NIa-pro); Nuclea Length = 2412 Score = 30.0 bits (66), Expect = 2.7 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = -1 Query: 381 PA*PCPVQTHPHNLFAKINHPTNHTLNVQF*GSN---IRQGKKRSGGVEWFTGIPVVHKF 211 PA +QT+P N+ A I H T+ + N + N +RQ + +WF+ + Sbjct: 946 PARVVTLQTNPANIQASITHLTHMSKNYKTLIENNQHVRQSMMTNVMFKWFSSTRITKDL 1005 Query: 210 IPNMIRATD 184 N+ R TD Sbjct: 1006 DRNLRRCTD 1014
>POL1_BAYMJ (Q01206) Genome polyprotein 1 [Contains: Protein P3; 6 kDa protein 1| (6K1); Cytoplasmic inclusion protein (CI); 6 kDa protein 2 (6K2); Viral genome-linked protein (VPg); Nuclear inclusion protein A (EC 3.4.22.44) (NI-a) (NIa) (NIa-pro); Nuclea Length = 2410 Score = 29.6 bits (65), Expect = 3.5 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = -1 Query: 381 PA*PCPVQTHPHNLFAKINHPTNHTLNVQF*GSN---IRQGKKRSGGVEWFTGIPVVHKF 211 PA +QT+P N+ A I H T+ + N + N +RQ + +WF+ + Sbjct: 946 PARVVTLQTNPANIQASITHLTHMSKNYKTLIENNQHVRQSMVTNVMYKWFSSTRITKDL 1005 Query: 210 IPNMIRATD 184 N+ R TD Sbjct: 1006 DRNLRRCTD 1014
>C12AA_BACTU (Q45754) Pesticidal crystal protein cry12Aa (Insecticidal| delta-endotoxin CryXIIA(a)) (Crystaline entomocidal protoxin) (142 kDa crystal protein) Length = 1257 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -1 Query: 357 THPHNLFAKINHPT----NHTLNVQF*GSNIRQGK 265 ++PHNL + HPT NHT++V N+ GK Sbjct: 667 SYPHNLLINLFHPTDPNRNHTIHVNNGDMNVDYGK 701
>CS1B_MOUSE (Q8CFG8) Complement C1s-B subcomponent precursor (EC 3.4.21.42) (C1| esterase) [Contains: Complement C1s-B subcomponent heavy chain; Complement C1s-B subcomponent light chain] Length = 688 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 265 FALPNVAASKLYI*GVVSW 321 F +PNV A K Y+ G+VSW Sbjct: 637 FQVPNVKAPKFYVAGLVSW 655
>LCE1B_HUMAN (Q5T7P3) Late cornified envelope protein 1B (Late envelope| protein 2) (Small proline-rich-like epidermal differentiation complex protein 2A) Length = 118 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 11 CAPKATRLCISPRMP*KVPPQNKSAFQC 94 C PK C++PR P K PP+ C Sbjct: 16 CIPKCPPKCLTPRCPPKCPPKCPPVSSC 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,292,308 Number of Sequences: 219361 Number of extensions: 1365765 Number of successful extensions: 3193 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3192 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)