| Clone Name | baal9a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NALP2_HUMAN (Q9NX02) NACHT-, LRR- and PYD-containing protein 2 (... | 29 | 3.0 | 2 | CLPP2_MYXXA (Q9X5N0) ATP-dependent Clp protease proteolytic subu... | 28 | 5.1 |
|---|
>NALP2_HUMAN (Q9NX02) NACHT-, LRR- and PYD-containing protein 2 (PYRIN domain-| and NACHT domain-containing protein 1) (PYRIN-containing APAF1-like protein 2) (Nucleotide-binding site protein 1) Length = 1062 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 122 RAGYCCTGSNNRRRARQFHTSWGCQQLCDKRHDSTDCSI 6 +AGY G N +RA++ ++GC+ D + + C I Sbjct: 552 QAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDI 590
>CLPP2_MYXXA (Q9X5N0) ATP-dependent Clp protease proteolytic subunit 2 (EC| 3.4.21.92) (Endopeptidase Clp 2) Length = 206 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = -3 Query: 183 AARSPLLLLVGAEGEAPSQMPCGILLHGQQQSQEGTSVSYQLGVSAALRQEARLHRLL 10 A+ +LLL GA+G+ + I++H G + ++ LR +A+L+ L+ Sbjct: 99 ASMGAVLLLAGAKGKRYALPSSRIMIHQPLGGVRGQATDIEIQAKEILRMKAKLNELI 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,052,650 Number of Sequences: 219361 Number of extensions: 394791 Number of successful extensions: 1042 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)