| Clone Name | baal8l01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CO4A2_HUMAN (P08572) Collagen alpha-2(IV) chain precursor | 30 | 5.4 | 2 | CO8A_RABIT (P98136) Complement component C8 alpha chain precurso... | 29 | 9.2 |
|---|
>CO4A2_HUMAN (P08572) Collagen alpha-2(IV) chain precursor| Length = 1712 Score = 29.6 bits (65), Expect = 5.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 73 PRSWKGEAGACRASDDNQA 129 P+ WKG+AG CR ++ ++A Sbjct: 473 PKGWKGDAGECRCTEGDEA 491
>CO8A_RABIT (P98136) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 585 Score = 28.9 bits (63), Expect = 9.2 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 9/60 (15%) Frame = +2 Query: 365 CMHARTIESNMCI*CTYVIY*HRVYMX-RXFGG--------DTANCXXPXXCXKPAXTGQ 517 C + E C C Y HR + FGG D A+C P C +PA GQ Sbjct: 39 CQLSSWSEWTDCFPCQDTKYRHRSLLQPNKFGGTICSGDIWDRASCYSPTACLRPAQCGQ 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,716,813 Number of Sequences: 219361 Number of extensions: 897656 Number of successful extensions: 1851 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1850 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)