| Clone Name | baal8k07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CMTA4_ARATH (Q9FYG2) Calmodulin-binding transcription activator ... | 28 | 8.2 | 2 | BLAR_BACLI (P12287) Regulatory protein blaR1 | 28 | 8.2 |
|---|
>CMTA4_ARATH (Q9FYG2) Calmodulin-binding transcription activator 4| (Signal-responsive protein 5) (Ethylene-induced calmodulin-binding protein d) (EICBP.d) (Ethylene-induced calmodulin-binding protein 4) (EICBP4) (AtFIN21) Length = 1016 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = -3 Query: 152 IASIDAASNRSAYSFTFGQ-------IHKGVILCAAPACVG*KSNLIIPAGE 18 I S S +S FG I +GVI C AP C K NL I +G+ Sbjct: 467 IGSFLCDPTESTWSCMFGNAQVPFEIIKEGVIRCEAPQCGPGKVNLCITSGD 518
>BLAR_BACLI (P12287) Regulatory protein blaR1| Length = 601 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 54 HTCRRST*NYSLVNLAKSKGVRAPVTGGINRCYI 155 HTC+ + V L++S +++P+T G+ R YI Sbjct: 159 HTCKEEIRFHQKVILSRSPLIKSPITFGVIRPYI 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,486,735 Number of Sequences: 219361 Number of extensions: 574772 Number of successful extensions: 958 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)