| Clone Name | baal8j18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y168_RICPR (Q9ZDZ5) Hypothetical UPF0088 protein RP168 | 28 | 5.8 |
|---|
>Y168_RICPR (Q9ZDZ5) Hypothetical UPF0088 protein RP168| Length = 198 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 108 LYSNKIQKRNAAHELSKSYMHVVEAETRLLLHEPL 4 +Y N N+ EL++ Y+H V+ RL +H+ L Sbjct: 6 IYINSNLAENSKLELARDYVHYVKTVLRLKIHDSL 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,511,567 Number of Sequences: 219361 Number of extensions: 517737 Number of successful extensions: 920 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)