ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal8f14 |
|---|---|
| Clone Library Name | barley_pub |
>STRB1_STRGR (P08078) Inosamine-phosphate amidinotransferase 1 (EC 2.1.4.2)| (Inosamine-phosphate amidinotransferase I) (Aminocyclitol amidinotransferase) (ADT) Length = 346 Score = 30.8 bits (68), Expect = 2.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 374 WLGAPKQQIEQEELGPQAPVGEQ 306 WL APK ++ + PQAP GE+ Sbjct: 147 WLSAPKPRLTDDSYAPQAPAGER 169
>AKA10_PIG (P57770) A kinase anchor protein 10, mitochondrial precursor| (Protein kinase A-anchoring protein 10) (PRKA10) (Dual-specificity A kinase-anchoring protein 2) (D-AKAP-2) (Fragment) Length = 650 Score = 30.8 bits (68), Expect = 2.3 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 243 SGPRPCGVLDNIGALEDTGERWSSSRTGSRARQPKEMEVRCSGTRGRRCPEARA 82 +GP P I A+ + +S SRT + +QP ME G GR C + +A Sbjct: 54 AGPSPVA----ISAISANMDSFSRSRTATLKKQPSHMEAAHFGDLGRSCLDYQA 103
>AKA10_MOUSE (O88845) A kinase anchor protein 10, mitochondrial precursor| (Protein kinase A-anchoring protein 10) (PRKA10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) Length = 662 Score = 30.4 bits (67), Expect = 3.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 210 IGALEDTGERWSSSRTGSRARQPKEMEVRCSGTRGRRC 97 I A+ + +SSSRT + +QP ME G GR C Sbjct: 73 INAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSC 110
>AKA10_HUMAN (O43572) A kinase anchor protein 10, mitochondrial precursor| (Protein kinase A-anchoring protein 10) (PRKA10) (Dual specificity A kinase-anchoring protein 2) (D-AKAP-2) Length = 662 Score = 30.4 bits (67), Expect = 3.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 210 IGALEDTGERWSSSRTGSRARQPKEMEVRCSGTRGRRC 97 I A+ + +SSSRT + +QP ME G GR C Sbjct: 73 INAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSC 110
>T240L_MOUSE (Q6JPI3) Thyroid hormone receptor-associated protein 2 (Thyroid| hormone receptor-associated protein complex 240 kDa component-like) Length = 2207 Score = 30.0 bits (66), Expect = 3.9 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 23/103 (22%) Frame = +2 Query: 11 NGWIHASPRWSVAVVGHLPEHLVPARASGHLLPLVP----------EHL--------TSI 136 N W+ + R ++ HLPEH+ S +L +VP EH+ + Sbjct: 1694 NFWLLSLMRCYTEMLDHLPEHM----RSSFILQIVPCQYMLQTMKDEHVFYIQYLKSMAF 1749 Query: 137 SLGCRAREPVREELHRSPVSSNAP-----MLSRTPQGRGPDQL 250 S+ C+ R P+ ++H ++ P M + P+ P QL Sbjct: 1750 SVYCQCRRPLPTQIHIKSLTGFGPAASIEMTLKNPERPSPIQL 1792
>ARMX1_HUMAN (Q9P291) Armadillo repeat-containing X-linked protein 1 (Protein| ALEX1) (ARM protein lost in epithelial cancers on chromosome X 1) Length = 453 Score = 29.6 bits (65), Expect = 5.0 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 8/76 (10%) Frame = -1 Query: 264 GARRRSWSGPRPCGVLD-NIGALEDTGERWSSSRTGSRAR-------QPKEMEVRCSGTR 109 G + ++ SG G L+ AL +T + +S++ G AR + + C G R Sbjct: 89 GVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCPGGR 148 Query: 108 GRRCPEARAGTRCSGR 61 G C R+G+R GR Sbjct: 149 GGGCHPTRSGSRAGGR 164
>FABH_SYNEL (Q8DKL4) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 329 Score = 29.6 bits (65), Expect = 5.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 237 PRPCGVLDNIGALEDTGERWSSSRTGSRAR 148 PR C ++ AL DT + W SRTG + R Sbjct: 16 PRQCLTNAHLSALVDTSDEWIQSRTGIQER 45
>ARMX1_PONPY (Q5R4B2) Armadillo repeat-containing X-linked protein 1| Length = 453 Score = 29.3 bits (64), Expect = 6.6 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 8/76 (10%) Frame = -1 Query: 264 GARRRSWSGPRPCGVLD-NIGALEDTGERWSSSRTGSRAR-------QPKEMEVRCSGTR 109 G + ++ SG G L+ AL +T + +S++ G AR + + C G R Sbjct: 89 GVKEKAHSGSHRGGGLEAKAKALFNTLKEQASAKAGKGARMGTITGNRTLAPSLPCPGGR 148 Query: 108 GRRCPEARAGTRCSGR 61 G C R+G+R GR Sbjct: 149 GGGCHPTRSGSRAGGR 164
>CAC1B_DISOM (P56698) Probable voltage-dependent N-type calcium channel alpha-1B| subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (DOE-4) Length = 2326 Score = 28.9 bits (63), Expect = 8.6 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = -1 Query: 276 RSRHGARRRSWSGPRPCGVLDNIGALEDTGERWSSSRTGSRARQPKEMEVRCSGTRGRRC 97 + R G R RS G R + +L+D ER R S ++ +GT+G R Sbjct: 896 KGRKGERSRSHEGGRRHHHAQS--SLDDAPER-EHRRHRSHRHGTEQQHREANGTKGERH 952 Query: 96 PEARAGTRCSGR 61 A+ G+R GR Sbjct: 953 SRAKDGSRSGGR 964
>SPKE_SYNY3 (P73515) Serine/threonine-protein kinase-like protein E| Length = 614 Score = 28.9 bits (63), Expect = 8.6 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 53 VGHLPEHLVPARASGHLLPLVPEHLTSISLGCRAREPVREELHRSPVSSNA 205 + +LP+H +P A +L +PE + EP +H+SP SS++ Sbjct: 235 LNNLPQHFLPTVAEFNLTSTIPEQTDNGVGKSSTGEPPFPTVHQSPESSSS 285
>POLG_HCVSA (O91936) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3013 Score = 28.9 bits (63), Expect = 8.6 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 276 RSRHGARRRSWSGPRPCGVLDNIGALE--DTGERW 178 R RHG R SG RP G+ D++ E D G W Sbjct: 1493 RGRHGIYRYVSSGERPSGIFDSVVLCECYDAGCAW 1527
>POLG_HCVEV (O39928) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3013 Score = 28.9 bits (63), Expect = 8.6 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 276 RSRHGARRRSWSGPRPCGVLDNIGALE--DTGERW 178 R RHG R SG RP G+ D++ E D G W Sbjct: 1493 RGRHGIYRYVSSGERPSGIFDSVVLCECYDAGCAW 1527 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,948,474 Number of Sequences: 219361 Number of extensions: 1185076 Number of successful extensions: 3989 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3983 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
