| Clone Name | baal8f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CO8A_RABIT (P98136) Complement component C8 alpha chain precurso... | 34 | 0.30 | 2 | COFG_METMP (Q6LYV9) FO synthase subunit 1 (EC 2.5.1.-) (7,8-dide... | 31 | 2.6 | 3 | CO4A2_HUMAN (P08572) Collagen alpha-2(IV) chain precursor | 30 | 7.5 |
|---|
>CO8A_RABIT (P98136) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 585 Score = 34.3 bits (77), Expect = 0.30 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 9/64 (14%) Frame = +3 Query: 390 CMHARTIESNMCI*CTYVIY*HR-VYMVRSFGG--------DTANCFVPFACIKPAATGQ 542 C + E C C Y HR + FGG D A+C+ P AC++PA GQ Sbjct: 39 CQLSSWSEWTDCFPCQDTKYRHRSLLQPNKFGGTICSGDIWDRASCYSPTACLRPAQCGQ 98 Query: 543 CIMC 554 C Sbjct: 99 DFQC 102
>COFG_METMP (Q6LYV9) FO synthase subunit 1 (EC 2.5.1.-)| (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1) Length = 352 Score = 31.2 bits (69), Expect = 2.6 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = -3 Query: 617 FLMNKSVH--LTQLVNVPIDRTQAHYTLSSGRRLDACEWHEAVCSISTKRPNHIHSVLVD 444 FL + S + L +L + + T H T S + C W VC T R + + +D Sbjct: 10 FLKSNSTNSILEKLGKINAENTSKHVTFSKNAFIPVCNWCRNVCGYCTFRNENFKLLKMD 69 Query: 443 HIRTLYT 423 ++ + T Sbjct: 70 EMKEILT 76
>CO4A2_HUMAN (P08572) Collagen alpha-2(IV) chain precursor| Length = 1712 Score = 29.6 bits (65), Expect = 7.5 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 98 PRSWKGEAGACRASDDNQA 154 P+ WKG+AG CR ++ ++A Sbjct: 473 PKGWKGDAGECRCTEGDEA 491 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,875,402 Number of Sequences: 219361 Number of extensions: 1394865 Number of successful extensions: 3529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3526 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)