| Clone Name | baal7p09 |
|---|---|
| Clone Library Name | barley_pub |
>ENV_MLVHO (P21436) Env polyprotein precursor [Contains: Coat protein GP76;| Spike protein p15E] Length = 666 Score = 30.8 bits (68), Expect = 3.4 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -3 Query: 326 PPAAALLEVGSRGPHRGPPEDGQRRPLLSPRRGLYDQLEPDELAGGRHCW 177 PP++ L + G+ GPP++G LL +G Y L + CW Sbjct: 286 PPSSNLTQGGTPSAPTGPPQEGTGDRLLDLVQGAYQALNATSPDKTQECW 335
>FGF12_RAT (P61150) Fibroblast growth factor 12 (FGF-12) (Fibroblast growth| factor homologous factor 1) (FHF-1) Length = 243 Score = 30.0 bits (66), Expect = 5.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 114 RSPSLFQIGEGEAQDQDQAGTPTM 185 R PSL +IGE + + + +GTPTM Sbjct: 209 REPSLHEIGEKQGRSRKSSGTPTM 232
>FGF12_MOUSE (P61329) Fibroblast growth factor 12 (FGF-12) (Fibroblast growth| factor homologous factor 1) (FHF-1) (Myocyte-activating factor) Length = 243 Score = 30.0 bits (66), Expect = 5.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 114 RSPSLFQIGEGEAQDQDQAGTPTM 185 R PSL +IGE + + + +GTPTM Sbjct: 209 REPSLHEIGEKQGRSRKSSGTPTM 232
>FGF12_HUMAN (P61328) Fibroblast growth factor 12 (FGF-12) (Fibroblast growth| factor homologous factor 1) (FHF-1) (Myocyte-activating factor) Length = 243 Score = 30.0 bits (66), Expect = 5.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 114 RSPSLFQIGEGEAQDQDQAGTPTM 185 R PSL +IGE + + + +GTPTM Sbjct: 209 REPSLHEIGEKQGRSRKSSGTPTM 232
>VMDL3_MOUSE (Q6H1V1) Bestrophin-4 (Vitelliform macular dystrophy 2-like protein| 3) Length = 669 Score = 29.6 bits (65), Expect = 7.6 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 323 PAAALLEVGSRGPHRGPPEDGQRR 252 PA LL+V SR PHRG P Q R Sbjct: 429 PARDLLDVPSRNPHRGSPTRKQSR 452 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,793,337 Number of Sequences: 219361 Number of extensions: 1233124 Number of successful extensions: 3806 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3804 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)