| Clone Name | baal8b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYFB_MAGMM (Q2VYZ1) Phenylalanyl-tRNA synthetase beta chain (EC ... | 32 | 1.9 | 2 | XYNA_PSEFL (P14768) Endo-1,4-beta-xylanase A precursor (EC 3.2.1... | 30 | 5.6 |
|---|
>SYFB_MAGMM (Q2VYZ1) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 798 Score = 31.6 bits (70), Expect = 1.9 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 109 PVPAACMPAPILTRSVPSAMVPGRVRSNRWIRRWLAISGL 228 P+P MP P+LT PG+ RS W+RR LA GL Sbjct: 478 PMPRPAMPKPVLT--------PGQRRSG-WVRRQLATRGL 508
>XYNA_PSEFL (P14768) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) (XYLA) Length = 611 Score = 30.0 bits (66), Expect = 5.6 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = -1 Query: 261 NPSSLASCSLMQTRDS*PTPDPSVATYAPRDHGRGHTPSEDGSRHACSWYWSLMP 97 +PSS+AS + S P SVA+ TP C+WY +L P Sbjct: 147 SPSSVASSVISSMASSSPVSSSSVAS---------STPGSSSGNQQCNWYGTLYP 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,172,682 Number of Sequences: 219361 Number of extensions: 1865058 Number of successful extensions: 4128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4124 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)