| Clone Name | baal8a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y978_MYCBO (P64770) Hypothetical protein Mb0978c | 29 | 5.0 | 2 | Y953_MYCTU (P64769) Hypothetical protein Rv0953c/MT0980 | 29 | 5.0 |
|---|
>Y978_MYCBO (P64770) Hypothetical protein Mb0978c| Length = 282 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 15 PAHRHRPMAR**IHPPINIARLICDRYMHGNNPFV 119 P H H P+ R HP A L DRYM +P+V Sbjct: 34 PEHTHIPVKRQAAHPTTGDASLPDDRYMRTLDPWV 68
>Y953_MYCTU (P64769) Hypothetical protein Rv0953c/MT0980| Length = 282 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 15 PAHRHRPMAR**IHPPINIARLICDRYMHGNNPFV 119 P H H P+ R HP A L DRYM +P+V Sbjct: 34 PEHTHIPVKRQAAHPTTGDASLPDDRYMRTLDPWV 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,364,447 Number of Sequences: 219361 Number of extensions: 1061210 Number of successful extensions: 2162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2162 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)