| Clone Name | baal7e08 |
|---|---|
| Clone Library Name | barley_pub |
>PURL_COREF (Q8FMM3) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 763 Score = 33.9 bits (76), Expect = 0.36 Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 12/72 (16%) Frame = -2 Query: 195 GSDGLDCGVAGTAAAGDSVVDTLLTAVSLR--KAPAEESAVL*SVEKLCTTRTP------ 40 G GL C + AAAGD + L AV LR K A E S E++C TP Sbjct: 285 GGGGLACATSELAAAGDGGMRVNLDAVPLRAEKMSAAEILASESQERMCAVVTPENVEKF 344 Query: 39 ----ASWDSVAA 16 A WD A Sbjct: 345 KQICAKWDVTVA 356
>PURL_NOCFA (Q5Z2C3) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 764 Score = 32.0 bits (71), Expect = 1.4 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 195 GSDGLDCGVAGTAAAGDSVVDTLLTAVSLRKAPAEESAVL--*SVEKLCTTRTPASWDSV 22 G GL C + AAAGD + L V LR A + +L S E++C TP + ++ Sbjct: 288 GGAGLSCATSELAAAGDGGMRIELDKVPLRAADMTPAEILSSESQERMCAVVTPENVEAF 347 Query: 21 AA 16 A Sbjct: 348 MA 349
>PURL_MYCTU (P0A5T8) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 754 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 195 GSDGLDCGVAGTAAAGDSVVDTLLTAVSLRKAPAEESAVL--*SVEKLCTTRTPASWDSV 22 G GL C + A+AGD + L +V LR + VL S E++C +P + D+ Sbjct: 282 GGAGLSCATSELASAGDGGMTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAF 341 Query: 21 AA 16 A Sbjct: 342 LA 343
>PURL_MYCBO (P0A5T9) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 754 Score = 30.8 bits (68), Expect = 3.1 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 195 GSDGLDCGVAGTAAAGDSVVDTLLTAVSLRKAPAEESAVL--*SVEKLCTTRTPASWDSV 22 G GL C + A+AGD + L +V LR + VL S E++C +P + D+ Sbjct: 282 GGAGLSCATSELASAGDGGMTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAF 341 Query: 21 AA 16 A Sbjct: 342 LA 343
>YEEJ_ECO57 (Q8X8V7) Hypothetical protein yeeJ| Length = 2660 Score = 30.4 bits (67), Expect = 4.0 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +2 Query: 281 VQESPAVNSPSTVSENAVDKPPPAMSFNFEQEVQVNQKEIMDMYMKSMQQFTESLAKM 454 V++ ++ P+ VSEN + PP S N EQ++ ++I + + M +E A M Sbjct: 109 VRQGDELDVPAQVSENNLTPPPGNSSGNLEQQIASTSQQIGSLLAEDMN--SEQAANM 164
>DIAP2_MOUSE (O70566) Protein diaphanous homolog 2 (Diaphanous-related formin-2)| (DRF2) (mDia3) Length = 1098 Score = 30.0 bits (66), Expect = 5.2 Identities = 18/63 (28%), Positives = 36/63 (57%) Frame = +2 Query: 278 TVQESPAVNSPSTVSENAVDKPPPAMSFNFEQEVQVNQKEIMDMYMKSMQQFTESLAKMK 457 T +E P + S + AV + PPA+ + ++ + +++KE++D++ K M+ + K K Sbjct: 59 TKREKPVIQH-SIDYQTAVVEIPPALIVHDDRSLILSEKEVLDLFEKMMEDMNLNEEK-K 116 Query: 458 LPL 466 PL Sbjct: 117 APL 119
>PURL_CORGL (Q8NMI5) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 762 Score = 29.6 bits (65), Expect = 6.8 Identities = 24/72 (33%), Positives = 28/72 (38%), Gaps = 12/72 (16%) Frame = -2 Query: 195 GSDGLDCGVAGTAAAGDSVVDTLLTAVSLR--KAPAEESAVL*SVEKLCTTRTP------ 40 G GL C + AAAGD + L V LR A E S E++C TP Sbjct: 285 GGGGLACATSELAAAGDGGMRVNLDNVPLRAENMSAAEILASESQERMCAVVTPENVERF 344 Query: 39 ----ASWDSVAA 16 A WD A Sbjct: 345 LEICAKWDVTCA 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,171,560 Number of Sequences: 219361 Number of extensions: 680929 Number of successful extensions: 2860 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2859 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)