| Clone Name | baal6k23 |
|---|---|
| Clone Library Name | barley_pub |
>TCF17_RAT (Q02975) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 576 Score = 31.6 bits (70), Expect = 2.2 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -3 Query: 117 RKASSQLPSNSSRYSRKRIHSSNDPGSTYRKSPSTFRFH 1 RKAS+ L +SRK+ + N+ G+T+ KS S+ R+H Sbjct: 306 RKASASLSGCQRAHSRKKTYLCNECGNTF-KSSSSLRYH 343
>CLOCK_HUMAN (O15516) Circadian locomoter output cycles protein kaput (hCLOCK)| Length = 846 Score = 30.8 bits (68), Expect = 3.7 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 183 SQSPLGDARYSSFHLCETLTQLRKASSQLPSNSSRYSRKRIHSS-NDPGSTYRKSPS 16 SQ D R ++ L E L R S PS SSR SRK H++ +DP ST K P+ Sbjct: 403 SQDSGSDNRINTVSLKEALE--RFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPT 457
>TCF17_MOUSE (Q61751) Zinc finger protein 354A (Transcription factor 17) (Renal| transcription factor Kid-1) (Kidney, ischemia, and developmentally-regulated protein 1) Length = 572 Score = 30.8 bits (68), Expect = 3.7 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = -3 Query: 117 RKASSQLPSNSSRYSRKRIHSSNDPGSTYRKSPSTFRFH 1 RKAS+ L +SRK+ + N+ G+T+ KS S+ R+H Sbjct: 302 RKASTSLSGCQRIHSRKKTYLCNECGNTF-KSSSSLRYH 339
>CLOCK_MOUSE (O08785) Circadian locomoter output cycles protein kaput (mCLOCK)| Length = 855 Score = 30.8 bits (68), Expect = 3.7 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 183 SQSPLGDARYSSFHLCETLTQLRKASSQLPSNSSRYSRKRIHSS-NDPGSTYRKSPS 16 SQ D R ++ L E L R S PS SSR SRK H++ +DP ST K P+ Sbjct: 403 SQDSGSDNRINTVSLKEALE--RFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPT 457
>BMS1_SCHPO (O94653) Ribosome biogenesis protein BMS1 homolog| Length = 1121 Score = 29.6 bits (65), Expect = 8.2 Identities = 21/69 (30%), Positives = 32/69 (46%) Frame = +2 Query: 269 ARHPVVLNVNDWMFCHGGLLPHHVEYGIERINKEVSNWMQGSSEDNDDTDLPFIATRGYD 448 +R+PVV+ GGLLP+ YG+ ++ + W + + ND P I + G Sbjct: 743 SRYPVVV---------GGLLPNEQRYGLVQVRIKRHRWHKKILKTND----PLIFSMG-- 787 Query: 449 SVVWTRFYS 475 W RF S Sbjct: 788 ---WRRFQS 793 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,574,665 Number of Sequences: 219361 Number of extensions: 2009468 Number of successful extensions: 5360 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5360 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)