| Clone Name | baal6k18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5161_ARATH (Q9M015) Protein At5g01610 | 30 | 4.0 |
|---|
>Y5161_ARATH (Q9M015) Protein At5g01610| Length = 170 Score = 30.0 bits (66), Expect = 4.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 3 TGHLDDRRISGLSGIRVRAFFRWWSITGIRADGDELVFEVG 125 TGHL+ +++ + GI+ + W +T I D ++ F G Sbjct: 109 TGHLEKGKLTDVEGIKTKVMI-WVKVTSISTDASKVYFTAG 148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,978,905 Number of Sequences: 219361 Number of extensions: 1229610 Number of successful extensions: 2997 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2997 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)