| Clone Name | baal6e02 |
|---|---|
| Clone Library Name | barley_pub |
>KCNAE_DROME (Q02280) Potassium voltage-gated channel protein eag (Ether-a-go-go| protein) Length = 1174 Score = 31.6 bits (70), Expect = 1.8 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = +3 Query: 117 ATPKQGLAHVAAPRSTSPAGQFCSGGTASRPLAPSSAGLARNVQFTAQE 263 A PKQ LA A + +PAG SG T+S AP+SA + Q TA + Sbjct: 1046 APPKQTLASTAGTATAAPAGVAGSGMTSS---APASADQQQQHQSTADQ 1091
>ADEC_LACPL (Q88SR1) Adenine deaminase (EC 3.5.4.2) (Adenase) (Adenine aminase)| Length = 563 Score = 30.8 bits (68), Expect = 3.1 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -3 Query: 489 TSNIHTIGIPGPWIYTDFPLIPIDFPSGFKAMVAADVCGQAIALELEQTH*AHDIGEVCA 310 T + IG+ I TD +PID F+A D+ + + + + H H+ G+V Sbjct: 368 TGLANVIGVQPNHIETDHLTLPIDATQNFEADCQRDI----LKMVVIERH--HNTGKVGV 421 Query: 309 GLFHGEGLR 283 GL HG L+ Sbjct: 422 GLVHGFALK 430
>MUCDL_HUMAN (Q9HBB8) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 845 Score = 30.0 bits (66), Expect = 5.3 Identities = 24/70 (34%), Positives = 26/70 (37%), Gaps = 3/70 (4%) Frame = +3 Query: 9 TSLRPPYSLISCPDWSASXKLGHQPTRLGLVISSVGATPKQGLAHVAAP---RSTSPAGQ 179 T+LRPP S A HQP G TPK G + P STS Sbjct: 508 TTLRPPTSSTPGGSPGAENSTSHQPATPG---GDTAQTPKPGTSQPMPPGVGTSTSHQPA 564 Query: 180 FCSGGTASRP 209 SGGT P Sbjct: 565 TPSGGTVQTP 574
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.0 bits (66), Expect = 5.3 Identities = 22/68 (32%), Positives = 29/68 (42%) Frame = -1 Query: 269 KLLLCGKLNVSCKACGRRSQRTTGCATRAELARWRRASWRRYVGEALLRRCANRGDDETE 90 KLL G+L R QR +GC AE W + + + L R CA GD + Sbjct: 666 KLLRDGELE-------RAVQRLSGCQRDAESFLWAEHAVVGEIADGLARACAALGDWQKS 718 Query: 89 ASRLVSQL 66 A+ L L Sbjct: 719 ATHLQRSL 726
>EMBP_RAT (Q63189) Eosinophil granule major basic protein precursor (MBP)| Length = 227 Score = 30.0 bits (66), Expect = 5.3 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 397 CFKSRWKVDGYEWEIRIYPRAGNPNRMNVRCVTL 498 C + RW +DG W Y AG P R RCVTL Sbjct: 174 CKRFRW-IDGSSWNFA-YWAAGQPRRGGGRCVTL 205
>ASPM_MOUSE (Q8CJ27) Abnormal spindle-like microcephaly-associated protein| homolog (Calmodulin-binding protein 1) (Spindle and hydroxyurea checkpoint abnormal protein) (Calmodulin-binding protein Sha1) Length = 3122 Score = 30.0 bits (66), Expect = 5.3 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 221 RRSQRTTGCATRAELARWRRASWRR 147 RR ++ T CATR + A WR SWR+ Sbjct: 2844 RRQEKITSCATRIQ-ALWRGYSWRK 2867
>ODO1_CAEBR (Q623T0) 2-oxoglutarate dehydrogenase E1 component, mitochondrial| precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) Length = 1027 Score = 30.0 bits (66), Expect = 5.3 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +1 Query: 91 SVSSSPLLAQRRSKASPT*RRHEARRQRASSALVAQPVVLWLLRPQALHETFN 249 ++S++PL+ QR+ + + +HE +SS + Q WL P ++H +++ Sbjct: 29 TISATPLVQQRKQSVAAS-VKHEPFLNGSSSVYIEQMYETWLENPSSVHTSWD 80
>TAOK2_MOUSE (Q6ZQ29) Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand| and one amino acid protein 2) Length = 1055 Score = 30.0 bits (66), Expect = 5.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 229 PADEGAKGRLAVPPEQNWPAGDVLRGAATWA 137 PA+ A+G A PP WP+ V R A W+ Sbjct: 931 PAEAAAQGYPAPPPAPAWPSRPVPRSGAHWS 961
>VIPR_MELGA (Q91085) Vasoactive intestinal polypeptide receptor precursor| (VIP-R) (VIP receptor) Length = 457 Score = 29.6 bits (65), Expect = 6.9 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 188 RAELAR-WRRASWRRYVGEALLRRCANRGDDETEASRLVSQLXRCGP 51 +AEL R WRR R++G + + G + T S +S L +C P Sbjct: 396 QAELKRKWRRWHLERFLGSDMKYHHPSLGSNGTNFSTQISMLTKCSP 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,980,755 Number of Sequences: 219361 Number of extensions: 1887887 Number of successful extensions: 5722 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 5467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5720 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)