| Clone Name | baal6b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZO2_CANFA (Q95168) Tight junction protein ZO-2 (Zonula occludens... | 31 | 1.8 | 2 | DLK_MOUSE (Q09163) Delta-like protein precursor (DLK) (Preadipoc... | 30 | 4.0 |
|---|
>ZO2_CANFA (Q95168) Tight junction protein ZO-2 (Zonula occludens 2 protein)| (Zona occludens 2 protein) (Tight junction protein 2) Length = 1174 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 212 GSSLQHCPPSFYGPGSYGRRGTKPATNLPRP 120 G+S + CPP S+GR KP+T +P P Sbjct: 1013 GASTRSCPPPIAAKPSFGRSILKPSTPVPSP 1043
>DLK_MOUSE (Q09163) Delta-like protein precursor (DLK) (Preadipocyte factor 1)| (Pref-1) (Adipocyte differentiation inhibitor protein) [Contains: Fetal antigen 1 (FA1)] Length = 385 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 10/42 (23%) Frame = -2 Query: 221 KNGGSSLQH--------CPPSFYGPGSYGRRGTKP--ATNLP 126 +NGG+ LQH C P F GP +RG P T+LP Sbjct: 220 QNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLP 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,848,641 Number of Sequences: 219361 Number of extensions: 1606337 Number of successful extensions: 3515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3514 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)